SecReT4
Protein ID: 218690001
T4SS name [ID]VirB [402]
Gene symbol-
Locus tagECED1_2274
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]2210612..2212501 [+]
Productputative MobB mobilization protein
Component typeVirD4
UniProt IDB7MWJ5
KEGG IDecq:ECED1_2274
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 3.4e-05, Aligned region: 430..536
Protein Sequence: 629 a.a.     [Download]
>gi|218690001|ref|YP_002398213.1| putative MobB mobilization protein [Escherichia coli ED1a]
MGRIADEGGMMILNKLTASLSPIVNGMLAVLAFVQQKQLVLALLAGLTMPFFASMKSDERQKAPLWKKLI
IAFSLLCFLSGTLAPVVIGSFQWLYKIRPTSDNTVLAWSVRIAFTVTGIIFHIMLRRIFTPELDKIKKRL
VKKTTLERELRTDVRTVKSLLPETLHYNPLDYIDLNKGIFTGMGRENEPMYLPLKDWQKQHADIIGTTGA
GKGVAAGILLYQSILAGEGVFVMDPKDDEWAPHLYRKACEDAGKPFALIDLRKQQYQLNLIEDITPDELE
ELFVAGFSLAEKGQESDFYRIDDRKAARIAAQFVSDNPSTTIRDVYNGDYVQSIAEKIKAFFGKIEELAL
LNAINSPEGFSLKHIFDEGGCCYVVGSMRNSKIITAQRMLLVRLYQLAEKRDRVIDVPRPIAVYLSELKY
HLSRSALEGLGAARDKGVHIIMDHQSIADLKDCPADLKGDAVVGAVVENAKFKLVYRVMDPDTAEWVARM
SGTILVDDELRKAKTDNMLTETIDSERTIRQAERFFIDSNMILNLPDFVSFIFTTKTLPSASLISPIKVR
KRQLKTFSVSPDIAATVAPVKIMLDFCEDDKPAMSDVMTTHPALFFDESEVKPVKPKPDDEEHLSPLDF
 
Nucleotide Sequence: 1890 bp     [Download]
>ref|NC_011745.1|:2210612-2212501 putative MobB mobilization protein [Escherichia coli ED1a]
ATGGGGCGAATCGCTGACGAAGGAGGCATGATGATTTTAAATAAGCTTACCGCTTCACTGTCCCCGATAG
TGAACGGGATGCTGGCGGTGCTGGCTTTTGTGCAACAGAAACAACTGGTGCTGGCATTATTAGCGGGGCT
GACGATGCCGTTTTTTGCATCAATGAAAAGCGATGAACGGCAGAAAGCGCCGCTCTGGAAAAAGCTGATT
ATTGCTTTTTCCCTGCTGTGTTTTCTCTCCGGCACACTGGCTCCGGTCGTTATCGGATCCTTTCAGTGGC
TGTATAAGATCAGACCCACCAGTGATAATACGGTACTGGCGTGGTCAGTACGGATTGCTTTCACTGTAAC
CGGGATTATTTTTCATATTATGCTTCGCCGGATATTCACACCGGAACTGGACAAAATAAAGAAACGCCTT
GTTAAAAAGACCACCCTTGAACGGGAATTGCGCACCGATGTCCGCACCGTAAAGTCCCTGCTGCCGGAAA
CACTGCATTATAACCCGCTGGATTATATCGACCTGAATAAAGGCATTTTTACCGGCATGGGCAGGGAAAA
TGAACCAATGTATCTCCCGTTAAAAGACTGGCAGAAACAACACGCGGATATTATCGGCACCACAGGGGCC
GGTAAAGGGGTAGCCGCCGGCATATTACTTTATCAAAGTATTCTGGCCGGTGAAGGTGTTTTTGTTATGG
ACCCCAAAGACGATGAATGGGCACCGCATCTTTACCGCAAAGCCTGCGAGGATGCAGGCAAGCCTTTTGC
CTTAATTGACCTGCGAAAACAGCAATACCAGTTAAATCTGATTGAAGATATCACGCCCGATGAGCTGGAA
GAATTGTTTGTTGCAGGTTTCAGCCTGGCAGAAAAAGGGCAGGAATCTGATTTTTATCGCATTGATGACC
GAAAAGCCGCCCGTATAGCCGCACAATTTGTCAGCGATAATCCATCGACAACAATCCGGGATGTTTATAA
CGGTGATTACGTTCAGAGTATTGCCGAAAAGATCAAAGCCTTTTTCGGAAAAATTGAGGAACTGGCATTA
CTCAATGCCATTAACTCACCAGAAGGCTTTTCGCTTAAGCACATATTTGATGAGGGCGGCTGCTGTTATG
TTGTCGGCTCCATGCGAAACAGCAAAATTATTACCGCCCAGCGCATGCTACTGGTTCGCCTTTACCAGCT
GGCAGAAAAGCGCGATCGAGTAATAGACGTCCCCCGCCCCATTGCTGTTTATCTTTCCGAACTGAAATAC
CATTTATCCAGGTCAGCACTGGAGGGATTAGGGGCAGCGCGTGATAAAGGCGTGCATATTATTATGGACC
ACCAGTCCATTGCCGATTTAAAAGACTGCCCGGCAGATTTGAAAGGTGACGCCGTTGTCGGTGCGGTCGT
TGAAAATGCCAAATTCAAACTGGTTTACCGGGTTATGGACCCGGATACAGCGGAATGGGTAGCGAGAATG
TCAGGCACTATTCTGGTGGATGACGAACTCCGTAAGGCTAAAACAGATAATATGCTCACGGAGACCATCG
ACAGTGAGCGCACAATCCGCCAGGCCGAACGTTTCTTTATTGACAGCAATATGATCCTGAACCTGCCCGA
TTTTGTCAGCTTTATCTTTACGACAAAAACGCTACCTTCTGCTTCACTGATCTCGCCGATAAAGGTCAGA
AAGCGCCAGCTAAAAACTTTTTCGGTTTCCCCTGATATTGCCGCAACGGTAGCCCCCGTGAAGATCATGC
TGGATTTTTGCGAGGATGATAAACCCGCCATGTCGGATGTGATGACAACACACCCGGCTCTTTTCTTCGA
CGAAAGCGAAGTCAAACCGGTAAAGCCGAAACCTGATGATGAAGAACACCTGTCCCCGCTGGATTTTTAA
 Primer design