SecReT4
Protein ID: 218691201
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3554
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3480094..3481614 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDB7N038
KEGG IDecq:ECED1_3554
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 7.4e-119, Aligned region: 8..487
Protein Sequence: 506 a.a.     [Download]
>gi|218691201|ref|YP_002399413.1| hypothetical protein ECED1_3554 [Escherichia coli ED1a]
MTTNNYLEYFLTLLGWLVNNGLWDLLIGTGLFALPLAFKVIGIWLKVREEGADEGNKGMLSLPSIENALY
GAFFVMVASCVPLVQVTLDTLKFDRSRAQTCGVWTPKAPGDTGYQGIISSLGDKTAAAPIWWVVVHKLSK
GVTQAAVASIPCRPDLRQLRFEVQRTFIANRALADELQDFTNDCYSLAMYQWKQRDQGMTKDRKVLSDIS
WIGSSTFMQGDYGTLQSRTPRAAFPWNNARDSGRPDTGRGGYPTCREWWNDSSVGLKKRVTEEVDEGLWL
RLSAAMKLLGNSQATYQEEIIKRLVSPANLTISQGGEVYRGYGGNADMTTMNAISRIGATAGSAVASLGA
FPAFDAMRQALPMVQSILLMAVYIMLPMILAFAAYEFSTLITLTFVVFALNFLTFWWELARWLDSWMITA
LYGSDTHSSLNMMGLQNTSDDIIMNLVMGTMFIVLPAVWLGALSWAGVNVGAAITNAARDGTSVAHQAGS
RAGDIAGKVRNSLGKK
 
Nucleotide Sequence: 1521 bp     [Download]
>ref|NC_011745.1|:c3481614-3480094 hypothetical protein ECED1_3554 [Escherichia coli ED1a]
GTGACGACCAATAACTATCTGGAATATTTTCTGACCCTGCTGGGCTGGCTGGTTAATAACGGTCTGTGGG
ATTTGCTGATCGGCACGGGACTGTTTGCGCTTCCTCTGGCTTTCAAAGTGATCGGTATCTGGCTGAAGGT
GAGGGAAGAGGGGGCGGACGAAGGCAACAAGGGGATGCTCTCGTTACCCAGCATCGAGAATGCATTGTAT
GGTGCGTTTTTTGTGATGGTGGCGTCCTGTGTACCGCTGGTTCAGGTGACGCTGGATACCCTGAAGTTTG
ATCGCAGCCGGGCTCAGACCTGTGGTGTGTGGACGCCGAAAGCCCCCGGGGACACCGGTTATCAGGGGAT
TATCAGCAGTCTGGGAGATAAGACTGCTGCGGCCCCGATCTGGTGGGTTGTTGTGCATAAGCTTTCCAAA
GGGGTGACACAGGCGGCCGTGGCGTCCATTCCCTGCAGGCCTGATCTGCGGCAACTGCGTTTTGAAGTGC
AGAGGACGTTCATTGCGAACAGGGCGCTGGCCGATGAGTTGCAGGATTTTACCAATGACTGCTACTCGCT
GGCGATGTACCAGTGGAAACAACGTGACCAGGGTATGACGAAGGACAGAAAGGTGCTGTCGGATATCAGC
TGGATTGGGAGCAGCACGTTCATGCAGGGGGATTACGGCACGCTGCAGTCCAGAACGCCAAGGGCGGCGT
TTCCGTGGAATAACGCCCGTGACAGCGGTCGTCCGGATACGGGGCGCGGAGGTTACCCAACGTGCAGGGA
GTGGTGGAACGACAGCAGTGTGGGGCTGAAAAAGCGGGTTACGGAGGAAGTTGATGAAGGGCTGTGGCTG
CGTCTTTCGGCAGCGATGAAGCTTCTGGGGAACAGCCAGGCGACTTATCAGGAGGAGATTATCAAACGGC
TGGTCAGTCCGGCTAACCTGACGATTTCTCAGGGGGGAGAAGTGTATCGGGGATATGGTGGTAATGCAGA
CATGACCACGATGAATGCCATTTCACGTATTGGCGCCACGGCAGGCTCAGCTGTCGCCAGTCTGGGGGCG
TTTCCGGCGTTTGATGCCATGCGGCAGGCGCTGCCGATGGTGCAGAGTATTCTGCTGATGGCGGTGTATA
TCATGCTTCCGATGATACTTGCTTTTGCGGCATATGAATTCAGTACGCTGATCACGCTGACGTTTGTTGT
GTTTGCGCTGAACTTTCTGACGTTCTGGTGGGAACTGGCGCGGTGGCTGGACAGCTGGATGATAACGGCG
CTGTATGGTTCAGATACACATTCGAGTCTGAATATGATGGGGCTGCAGAACACGTCGGACGATATCATCA
TGAACCTGGTGATGGGGACGATGTTTATTGTGTTGCCAGCAGTGTGGCTGGGGGCATTATCCTGGGCCGG
AGTAAATGTCGGTGCAGCTATCACTAATGCAGCTAGAGATGGAACAAGCGTGGCACATCAAGCAGGCTCA
AGGGCTGGAGATATCGCTGGGAAAGTGAGAAACTCTTTGGGGAAAAAATAA
 Primer design