SecReT4
Protein ID: 218691203
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3556
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3481976..3483457 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDB7N040
KEGG IDecq:ECED1_3556
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 493 a.a.     [Download]
>gi|218691203|ref|YP_002399415.1| hypothetical protein ECED1_3556 [Escherichia coli ED1a]
MLQETGTDIPWQYEFLRRRMMTMKVKTLVMMVMLSCSTPVMADSILSLPKLNDSTFGYGKSVDGAVSDKL
FYTLGGGSVISQPATRSNMQKLGLDLGWSSDLMCGNFDLKTTVGNQLNGITDGFKNLMGDVIQGASGAVA
SLPAMVIQRANPGLYDMLTNGVLQANVAFDKAQLNCQNMAKRMMDFSDRSKWTQAAMMEEYKKVVNTSDG
DAVKGDDAGRQATGKEGQKWIGGQQRGGAGQPAIRPVHDMTAAGFNMMNSLPVTSTSGVGAGSCNGSACE
KFRNAEEAASAVVKVLGDRSMRTCTDAKECTSGDSDQQPGTAVAGTGFSPMLEEATRINTEQLVRLVNGQ
DKPTAENLAKLKTGSLAVSAGVIHALRRDPDNMSLTSRLAGELAMADTVETALVMRRMLLTGMSEPYAAA
QPAALEEGDRRIASLDREIIALKSEMELKRDLARNSVLTIIERDNERVSNNPMIQQTDNADSRVRSLEVP
ENE
 
Nucleotide Sequence: 1482 bp     [Download]
>ref|NC_011745.1|:c3483457-3481976 hypothetical protein ECED1_3556 [Escherichia coli ED1a]
TTGCTGCAAGAAACGGGGACAGACATTCCTTGGCAGTACGAATTTTTAAGGAGACGGATGATGACGATGA
AGGTAAAGACTCTGGTGATGATGGTGATGCTGTCCTGTAGTACGCCGGTCATGGCAGACAGTATTCTCTC
GCTGCCAAAACTGAATGACAGCACGTTTGGTTACGGAAAATCGGTGGATGGTGCGGTGTCGGACAAGCTG
TTTTACACCCTGGGCGGTGGCTCCGTTATTTCCCAGCCGGCGACGCGCAGTAATATGCAGAAGCTCGGGC
TGGACCTGGGCTGGAGCAGCGATCTGATGTGCGGGAACTTCGATCTGAAAACCACAGTAGGAAACCAGCT
CAACGGGATCACTGACGGTTTTAAAAACCTGATGGGGGATGTGATTCAGGGGGCGAGCGGAGCCGTGGCG
AGTCTGCCGGCAATGGTGATACAGCGGGCTAATCCGGGGCTGTATGACATGCTGACCAACGGTGTACTGC
AGGCGAATGTGGCATTCGACAAAGCGCAGCTCAATTGCCAGAACATGGCGAAACGGATGATGGATTTTTC
CGATCGCAGCAAGTGGACGCAGGCCGCGATGATGGAGGAGTACAAAAAGGTTGTTAATACCAGTGACGGT
GATGCCGTTAAAGGTGATGACGCCGGACGCCAGGCAACGGGGAAAGAGGGGCAGAAATGGATTGGTGGTC
AGCAGCGTGGCGGTGCCGGTCAGCCCGCCATCCGCCCGGTTCATGACATGACGGCCGCGGGGTTTAATAT
GATGAACAGTCTGCCGGTGACCAGTACATCTGGTGTTGGTGCGGGAAGCTGTAATGGCAGTGCCTGTGAG
AAATTCAGGAATGCAGAGGAGGCGGCCAGCGCTGTGGTGAAGGTACTGGGTGATCGTTCAATGCGCACCT
GTACGGATGCGAAGGAATGTACCAGTGGTGACTCAGACCAGCAGCCGGGAACGGCGGTGGCCGGAACAGG
GTTTTCGCCGATGCTTGAGGAGGCGACACGCATAAATACGGAACAGCTGGTTCGCCTCGTGAACGGGCAG
GATAAGCCCACGGCAGAGAATCTGGCAAAACTGAAGACCGGCAGTCTGGCGGTATCTGCCGGGGTGATAC
ATGCGCTGCGTCGCGATCCGGACAATATGTCCCTGACCTCCCGTCTGGCCGGTGAACTGGCGATGGCTGA
TACGGTGGAAACGGCACTGGTGATGCGCAGAATGCTGCTCACAGGAATGTCTGAACCGTATGCGGCTGCA
CAGCCTGCCGCGCTGGAAGAAGGCGATCGTCGTATTGCCTCTTTGGACAGGGAGATCATCGCCCTGAAAA
GTGAGATGGAGCTGAAACGGGATCTGGCGCGTAACAGTGTGCTGACCATCATTGAGCGTGACAATGAACG
TGTGAGCAATAACCCGATGATTCAGCAGACCGACAACGCTGACAGCCGTGTCCGTTCACTGGAGGTTCCT
GAAAATGAATAA
 Primer design