SecReT4
Protein ID: 218691204
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3557
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3483409..3484383 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDB7N041
KEGG IDecq:ECED1_3557
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4.1e-90, Aligned region: 31..312
Protein Sequence: 324 a.a.     [Download]
>gi|218691204|ref|YP_002399416.1| hypothetical protein ECED1_3557 [Escherichia coli ED1a]
MMSRSFRLRAGALLLSVAALPLASASLNTASIVASAAAPDCISWRVSGICYWLYCSGFSCKVRTSVKVTH
YIPEVVVSTYTAPGGNPWKEMALVSQTAGGVENSITKGLAGLSAGGGNPADMKAQGERRSAIRFKYADAL
GHPATRLIGGMVPGFSCDSPVTPAMPYFLSTLDSLVWRTGMPESLYPEALIPGKREIGSQAEENLWGSVY
PRSGFVMQTDDDKAAAVVAQRVADIISRTGEPHVYKSIQTRKKDGFWPPDPVEENTDTRNHKWQRLTPSV
SRSCAVFPDGDHQAAEDGNAAFALWQPYSCCKKRGQTFLGSTNF
 
Nucleotide Sequence: 975 bp     [Download]
>ref|NC_011745.1|:c3484383-3483409 hypothetical protein ECED1_3557 [Escherichia coli ED1a]
ATGATGAGCCGGTCATTTCGTCTGCGTGCCGGGGCCCTGCTGCTGAGTGTTGCAGCTCTGCCTCTGGCGT
CAGCCTCACTGAATACAGCCAGTATTGTGGCCAGTGCGGCAGCACCGGATTGTATCAGCTGGCGGGTCAG
CGGAATTTGCTACTGGCTGTACTGCTCCGGGTTCAGCTGTAAGGTCAGAACATCGGTGAAAGTGACACAT
TATATTCCGGAAGTGGTGGTATCCACCTACACCGCACCGGGTGGTAATCCCTGGAAAGAGATGGCGCTGG
TCAGTCAGACTGCCGGAGGGGTGGAGAATTCTATTACGAAAGGCCTAGCGGGGTTGAGTGCCGGTGGGGG
AAATCCTGCGGATATGAAAGCTCAGGGAGAGCGTCGTTCGGCCATTCGTTTTAAATATGCCGACGCGCTG
GGGCATCCGGCAACGCGTCTTATTGGCGGAATGGTGCCGGGATTCAGCTGCGATTCGCCGGTGACACCGG
CAATGCCTTATTTCCTGAGTACCCTGGACAGTCTCGTCTGGCGGACCGGAATGCCTGAATCCCTGTATCC
GGAAGCCCTCATTCCCGGTAAACGTGAAATCGGCAGTCAGGCTGAAGAAAACCTGTGGGGCAGTGTTTAT
CCCCGTTCAGGTTTTGTGATGCAGACAGATGATGACAAGGCGGCGGCCGTGGTTGCCCAGCGGGTGGCTG
ACATCATCAGCCGGACCGGTGAGCCACATGTTTATAAATCAATACAGACCCGGAAAAAGGATGGTTTCTG
GCCGCCGGATCCGGTTGAGGAAAATACGGACACCCGTAACCACAAGTGGCAGAGACTGACGCCCTCCGTC
TCCCGCTCCTGCGCCGTGTTTCCTGACGGAGACCATCAGGCCGCGGAGGATGGTAATGCCGCTTTTGCGC
TCTGGCAACCCTACAGTTGCTGCAAGAAACGGGGACAGACATTCCTTGGCAGTACGAATTTTTAA
 Primer design