SecReT4
Protein ID: 218691205
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3558
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3484380..3484778 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDB7MZP6
KEGG IDecq:ECED1_3558
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 2.1e-36, Aligned region: 18..126
Protein Sequence: 132 a.a.     [Download]
>gi|218691205|ref|YP_002399417.1| hypothetical protein ECED1_3558 [Escherichia coli ED1a]
MHRIIFSSLFFLPTAVSAGITLYTDSQHPPVNPPSDVRVILLDGPEQLQARFFGALPADAGEAEERVRAR
MQSPEWGAMQAELAERYREVAHAWSLGVKKYPAVVFDDRDVVYGTTDVAEAAQLRAQEGVQP
 
Nucleotide Sequence: 399 bp     [Download]
>ref|NC_011745.1|:c3484778-3484380 hypothetical protein ECED1_3558 [Escherichia coli ED1a]
ATGCACCGGATTATATTCAGTTCCCTGTTTTTCCTGCCGACGGCGGTATCAGCCGGCATAACCCTTTATA
CCGATTCTCAACATCCTCCTGTAAACCCGCCTTCAGACGTGCGGGTGATCCTTCTGGATGGTCCTGAACA
ACTGCAGGCTCGTTTTTTTGGTGCATTGCCCGCCGATGCCGGTGAGGCCGAAGAAAGGGTCAGAGCGCGT
ATGCAGTCCCCGGAGTGGGGGGCGATGCAGGCGGAGTTGGCTGAGCGTTACCGGGAGGTGGCGCATGCAT
GGTCACTGGGCGTGAAGAAATATCCGGCCGTGGTCTTTGATGATCGTGACGTGGTCTACGGTACCACGGA
TGTGGCAGAGGCCGCACAACTGAGAGCACAGGAAGGAGTTCAGCCATGA
 Primer design