SecReT4
Protein ID: 218691208
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3561
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3487487..3487873 [-]
Producthypothetical protein
Component typeTfc17
UniProt IDB7MZP9
KEGG IDecq:ECED1_3561
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|218691208|ref|YP_002399420.1| hypothetical protein ECED1_3561 [Escherichia coli ED1a]
MMYLKYPEPELQTVVHPGGVVFFLPPQGKPGVTEITQPHLLRLRSHLNRRLGKLRRVVCQPQRVGMNSSV
AVTLEGDTGKVYLLVSVGGHECWPSEEEYTHLRWYIQVVDAADLLYLLLWLNGMEAEK
 
Nucleotide Sequence: 387 bp     [Download]
>ref|NC_011745.1|:c3487873-3487487 hypothetical protein ECED1_3561 [Escherichia coli ED1a]
ATGATGTATCTGAAATATCCGGAGCCGGAGCTGCAGACAGTGGTGCATCCGGGTGGCGTTGTGTTTTTTT
TGCCGCCACAGGGTAAGCCCGGGGTGACAGAGATAACACAGCCGCATCTTCTGCGGCTGCGCTCACACCT
TAATCGTCGTCTGGGAAAGTTGCGTCGTGTTGTATGCCAGCCCCAGCGGGTTGGCATGAACAGCAGTGTG
GCTGTGACGCTGGAAGGTGATACCGGAAAGGTCTATCTGCTTGTTTCCGTGGGGGGCCATGAATGCTGGC
CGTCAGAGGAGGAGTATACGCATCTGAGATGGTATATCCAGGTTGTGGATGCGGCAGATTTGCTCTATCT
GCTGTTGTGGCTGAATGGTATGGAGGCAGAAAAATAA
 Primer design