SecReT4
Protein ID: 218691209
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3562
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3487870..3490686 [-]
Productputative plasmid-related outer membrane ATPase
Component typeTfc16
UniProt IDB7N046
KEGG IDecq:ECED1_3562
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 8.6e-63, Aligned region: 54..322
AAA_10 [PF12846], Evalue: 2.8e-43, Aligned region: 516..851
Protein Sequence: 938 a.a.     [Download]
>gi|218691209|ref|YP_002399421.1| putative plasmid-related outer membrane ATPase [Escherichia coli ED1a]
MAFTLFKRRNVTTPSETEAAGQGFVPPVPPGAQPLKRPGQMTQEEEARVYHAGPSVIDFLPWVEYLDEAQ
CLLLDDGMSVGAVYDVTPAATEGRTDERLEQIRDMVEDALQDSFDEYDTHPWVVQFFCQDENDVDAYLDY
LKGYVKPHAQGTAFTEAWLGEMERHLRGIARPEGLFTDTLVTGQPWRGQQRRTRMVIYRRIAKNNSDPMP
PVAMLNQVCDRVVSALGSAGVRCHRMNGLQVHSWLLRLFNPAPSWISREDLYRMASRADPRENDADVMPV
MTDFAESLWFNPPYSDPENGVWWIDDLPHCAVVVEKLRTPPEPGAITGEMSRGEKTVNALMDTFPEGTVL
CMTIVVQPQDTLEERFTRLSKNAVGENTESIRARQDVKVVKELLGNRHKLYRAGITFLLRAGDMDSLKRK
RVELTTVLLGAGLQPVRPEFDVGPLNSWLRALPMCFDPDMDRKQWYTRLMWVQHLAGLLPVTGRENGTGH
PGFSFFNRGGDVLTFDPLNKLDRTQNAHLLLFGPTGAGKSATLCASLSQVMAVHRPRLFIAEAGNSFGLL
ADYFESLGLSVNKISVKPGSGVTLPPFADAHKLVEEGQTLQSVDEHSLPDLDGDEEEDKRDILGEMEISA
RMMITGGDPKEEASLKRADRAMIREALLMATHATYREGRQMLPEDLQVALREISCDAGRNEVRRAKAAEM
AESLGMFTQKGSFEAELFNREGELWPEADVTLIDLGHLAREGYEAQMALTMVSMTNMINNIAERDQYLGR
DIVFAVDEAHIVTVNPLLSPYMTKVVKMWRKLGAWLWLATQNLKDYPDISEKMLNMAEWWVCLTMPPEEV
NNIARFKSLTEEQKAVLMSASKLSGCYTEGGVLAKKIEALFRAVPPSLYLALGMTEKEEKAERRMLMKEH
NCSELEAAFHVARKLDRLRGLSAVESAA
 
Nucleotide Sequence: 2817 bp     [Download]
>ref|NC_011745.1|:c3490686-3487870 putative plasmid-related outer membrane ATPase [Escherichia coli ED1a]
ATGGCATTCACACTGTTTAAACGTCGCAATGTCACCACGCCATCTGAAACGGAGGCGGCAGGACAGGGTT
TTGTTCCGCCTGTCCCGCCCGGGGCACAGCCCCTGAAACGTCCGGGGCAGATGACGCAGGAAGAGGAGGC
CCGGGTTTATCATGCCGGGCCGTCAGTTATTGATTTTCTTCCCTGGGTGGAGTACCTGGATGAGGCTCAG
TGTCTGCTGCTGGATGACGGAATGTCGGTAGGGGCTGTTTATGACGTGACGCCGGCGGCGACAGAAGGGC
GTACGGATGAACGTCTTGAACAGATCAGGGACATGGTGGAGGACGCACTGCAGGACAGCTTTGATGAGTA
TGACACGCATCCCTGGGTGGTGCAGTTCTTCTGCCAGGATGAAAATGACGTGGATGCGTATCTTGATTAT
CTGAAAGGCTATGTGAAACCTCACGCGCAGGGAACGGCGTTTACTGAAGCCTGGCTGGGCGAAATGGAAC
GCCATTTGCGGGGAATTGCCCGCCCGGAAGGCCTTTTTACAGACACGCTGGTTACCGGTCAGCCGTGGCG
GGGACAGCAGCGGAGAACCCGTATGGTGATTTATCGTCGTATCGCGAAGAACAACAGTGATCCGATGCCG
CCGGTGGCCATGCTGAATCAGGTTTGCGATCGCGTTGTGTCGGCACTGGGGAGCGCCGGGGTGCGCTGTC
ACCGGATGAACGGTCTGCAGGTTCACAGCTGGTTACTCCGGTTATTTAATCCGGCACCGTCCTGGATTAG
CCGGGAGGATTTGTACCGGATGGCCTCAAGAGCCGATCCCCGTGAGAACGATGCGGATGTTATGCCGGTG
ATGACGGACTTTGCAGAAAGCCTGTGGTTTAATCCGCCCTATTCCGATCCGGAGAACGGGGTGTGGTGGA
TTGATGATCTGCCACATTGTGCCGTGGTGGTGGAGAAGCTCCGTACGCCACCGGAGCCCGGAGCCATTAC
CGGTGAGATGTCCCGGGGAGAAAAAACGGTGAATGCGCTGATGGATACGTTTCCGGAAGGAACGGTGCTG
TGCATGACCATTGTGGTACAGCCACAGGATACCCTGGAGGAGCGGTTTACCCGGCTGTCGAAAAATGCCG
TGGGTGAGAATACGGAGTCCATCCGGGCACGTCAGGATGTGAAGGTGGTGAAGGAGTTGCTGGGTAACCG
ACATAAACTCTATCGTGCGGGGATCACCTTCCTTCTGCGGGCCGGTGATATGGACAGCCTGAAACGTAAA
CGGGTGGAGCTGACCACGGTTCTGCTGGGGGCAGGCCTGCAGCCGGTGCGACCGGAGTTTGATGTGGGGC
CGCTGAACAGCTGGCTGCGTGCGCTGCCAATGTGCTTTGATCCGGATATGGACAGAAAGCAGTGGTACAC
ACGTCTGATGTGGGTACAGCATCTCGCTGGGCTTCTGCCGGTGACCGGCCGGGAAAACGGTACAGGGCAT
CCCGGCTTCAGTTTTTTTAACCGAGGGGGAGATGTCCTGACGTTTGATCCCCTGAACAAACTGGATCGTA
CCCAGAATGCCCATCTGTTGCTGTTCGGGCCCACGGGGGCAGGGAAGTCTGCCACGCTGTGTGCCTCTCT
GTCACAGGTGATGGCCGTGCATCGTCCCCGGTTGTTTATTGCCGAGGCGGGTAACTCGTTTGGTCTGCTG
GCCGATTACTTTGAAAGTCTCGGGCTTTCGGTGAACAAAATCAGTGTCAAACCGGGGAGCGGTGTGACAC
TGCCACCCTTTGCGGATGCGCATAAGCTGGTTGAAGAAGGGCAGACCCTGCAGAGTGTGGATGAGCACTC
GCTGCCCGATCTGGATGGCGATGAAGAGGAGGATAAACGCGACATTCTGGGAGAAATGGAAATCTCTGCC
AGGATGATGATCACCGGCGGTGATCCGAAGGAAGAGGCCTCACTCAAACGTGCGGACCGGGCGATGATTC
GTGAAGCGCTGCTGATGGCCACACACGCGACGTACCGGGAAGGGCGACAGATGCTGCCGGAAGATTTGCA
GGTGGCACTCCGGGAAATCTCCTGTGATGCGGGACGTAACGAGGTACGCCGGGCAAAGGCGGCAGAGATG
GCGGAGTCACTGGGAATGTTCACCCAGAAAGGGAGTTTTGAAGCGGAGCTGTTCAACCGTGAAGGCGAAC
TGTGGCCGGAAGCGGATGTGACGCTGATAGACCTGGGGCACCTGGCCCGTGAGGGGTATGAGGCGCAGAT
GGCTCTGACGATGGTGTCAATGACCAATATGATTAACAACATCGCTGAACGTGACCAGTATCTGGGGCGT
GATATTGTGTTTGCAGTGGATGAGGCGCATATCGTGACGGTGAATCCGCTGCTCTCGCCCTATATGACGA
AGGTGGTGAAAATGTGGCGCAAGCTGGGAGCCTGGCTGTGGCTTGCGACGCAGAACCTGAAGGACTATCC
GGATATATCAGAGAAAATGCTGAACATGGCGGAGTGGTGGGTGTGTCTGACGATGCCGCCGGAAGAGGTG
AACAACATTGCCCGTTTTAAATCCCTGACGGAGGAGCAGAAGGCGGTGCTGATGTCGGCGAGCAAACTGT
CCGGCTGTTATACGGAGGGGGGTGTCCTGGCGAAGAAGATTGAGGCGCTGTTCCGTGCGGTGCCACCGAG
TCTTTATCTGGCTCTGGGGATGACGGAGAAAGAAGAGAAGGCTGAGCGGCGCATGCTGATGAAGGAACAT
AACTGCAGCGAACTGGAGGCTGCGTTCCATGTGGCCCGTAAACTGGACAGACTGCGGGGACTTTCCGCCG
TGGAGAGTGCGGCATGA
 Primer design