SecReT4
Protein ID: 218691210
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3563
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3490686..3491099 [-]
Productputative lipoprotein
Component typeTfc15
UniProt IDB7N047
KEGG IDecq:ECED1_3563
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 137 a.a.     [Download]
>gi|218691210|ref|YP_002399422.1| putative lipoprotein [Escherichia coli ED1a]
MRRLRLVMCIPLAALLLSGCSTSKEELLPAGDQTMLELWQGKTTGGSQRHAQAARETLWRPLTSDEKQQV
HKEGQSYSRTQESEISQQFPRLPNPDMVMYVFPHLAGGTSPVPGYSTIFPFYSRTQYALPGERTEAM
 
Nucleotide Sequence: 414 bp     [Download]
>ref|NC_011745.1|:c3491099-3490686 putative lipoprotein [Escherichia coli ED1a]
GTGAGACGATTACGGTTAGTTATGTGTATCCCCCTGGCTGCCCTGCTGTTATCCGGGTGCTCCACCTCGA
AAGAGGAGCTTCTGCCGGCGGGCGATCAGACCATGCTTGAACTCTGGCAGGGGAAAACAACGGGGGGGAG
CCAGCGACATGCGCAGGCCGCCAGGGAGACACTGTGGCGGCCCCTGACGTCAGATGAGAAACAGCAGGTA
CACAAGGAGGGCCAGAGCTACAGCAGGACGCAGGAAAGTGAAATCAGTCAGCAGTTTCCCCGTCTGCCAA
ACCCTGACATGGTGATGTACGTATTCCCGCATCTTGCCGGCGGGACGTCACCGGTGCCGGGATACAGCAC
GATATTTCCTTTTTACAGCAGAACGCAGTATGCGTTACCAGGTGAGCGTACGGAGGCGATGTAA
 Primer design