SecReT4
Protein ID: 218691211
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3564
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3491117..3492595 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDB7N358
KEGG IDecq:ECED1_3564
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.9e-05, Aligned region: 358..464
Protein Sequence: 492 a.a.     [Download]
>gi|218691211|ref|YP_002399423.1| hypothetical protein ECED1_3564 [Escherichia coli ED1a]
MQIKSNALVKFVVPAVVLVGLAVTMKSCKTQENVADRGEQARTLSGLSSEELRALGVEGDTPEDTLRTLV
ARMNQVRDNQRTLEKQNSQLLKDNEQLRRRSTDVSGQVNDAVAGVQKTYEQKQRKLQEQQHSLMSQIDAM
KDQLSRAETLSRRQESDIPPGLGLDAGGGSGVVITQGADGLMWVSPADQSQDDPLSSSGSKGGPRFPTSF
LEDNALSRQKAEYEQQVKGYSNEQQRATTQAVYTLPENSTLTGSRAMTALLGRVPINGTVTDPYPFKILV
GRDNLTANGIELPDVEGAIVSGTASGDWTLSCVRGQVNSITFVFADGTVRTLPSPDVNGTTNSNQQAKGN
GTGGIGWISDEDGIPCISGTRKSNASSYLPTIFALSAAGAAGDALSEGQYTSQNNVNGITSTLTGSAGQA
ALGKALSGGMNETADWVRQRYGQTFDAIYVPPGKALAVHITRQLAIDYEEQGRRVRYDFALPGEANDHGG
LD
 
Nucleotide Sequence: 1479 bp     [Download]
>ref|NC_011745.1|:c3492595-3491117 hypothetical protein ECED1_3564 [Escherichia coli ED1a]
ATGCAGATTAAGTCCAACGCGCTGGTGAAATTTGTGGTGCCCGCTGTTGTTCTGGTGGGGCTTGCAGTCA
CGATGAAAAGCTGCAAAACGCAGGAAAATGTTGCTGACCGCGGGGAGCAGGCCCGGACCTTATCCGGATT
ATCGTCAGAAGAGCTACGGGCTCTTGGGGTGGAAGGTGACACGCCGGAAGACACATTACGGACGCTGGTC
GCCCGTATGAACCAGGTGCGGGACAATCAGAGAACGCTGGAGAAACAGAACTCGCAACTTCTTAAGGATA
ACGAGCAGCTGCGCAGGCGGAGCACGGATGTGTCCGGTCAGGTGAATGACGCTGTGGCAGGGGTGCAGAA
AACCTACGAACAGAAGCAGCGGAAACTGCAGGAGCAGCAGCATTCCCTGATGTCGCAGATTGACGCCATG
AAAGATCAACTGAGCCGGGCAGAGACGCTCAGTCGCCGCCAGGAAAGCGATATCCCGCCGGGGCTCGGGC
TTGATGCGGGCGGCGGCAGTGGCGTGGTGATTACGCAGGGGGCTGACGGGCTGATGTGGGTAAGTCCGGC
CGATCAGTCTCAGGATGATCCCCTGAGCAGCAGTGGTTCAAAGGGAGGCCCTCGTTTTCCGACCTCATTC
CTTGAGGACAACGCACTGAGTCGTCAGAAGGCTGAGTATGAGCAGCAGGTGAAGGGATACAGCAATGAAC
AGCAGCGAGCCACCACACAGGCGGTCTACACGCTGCCGGAAAATTCAACGCTGACAGGCAGTCGTGCGAT
GACGGCCCTGCTGGGGCGGGTGCCGATCAACGGCACCGTGACGGACCCTTACCCGTTCAAGATCCTGGTC
GGGCGTGACAACCTCACGGCAAACGGCATTGAGCTGCCGGATGTGGAAGGGGCGATTGTCTCCGGCACGG
CCAGTGGTGACTGGACGCTTTCCTGTGTGCGCGGGCAGGTGAACAGTATCACCTTTGTTTTTGCTGATGG
CACGGTGCGCACGCTGCCGTCACCGGATGTCAACGGCACCACCAACAGCAATCAGCAGGCGAAGGGGAAT
GGTACTGGCGGGATTGGCTGGATCTCCGATGAAGACGGTATTCCCTGCATCAGCGGTACCCGTAAATCCA
ATGCGTCAAGTTATCTGCCAACGATATTTGCACTGTCAGCCGCCGGTGCAGCCGGGGATGCCCTGAGTGA
GGGGCAGTATACCTCGCAGAACAATGTCAACGGTATCACCTCCACGCTGACCGGCAGCGCGGGGCAGGCT
GCACTTGGTAAGGCGCTGTCCGGTGGAATGAATGAGACGGCAGACTGGGTGAGGCAGCGTTACGGGCAGA
CGTTTGATGCCATTTATGTTCCTCCGGGGAAAGCGCTGGCGGTACATATTACCCGACAACTGGCTATTGA
TTATGAAGAGCAAGGCCGCCGTGTGCGTTATGACTTCGCCCTGCCGGGTGAAGCAAACGACCACGGGGGG
CTTGACTGA
 Primer design