SecReT4
Protein ID: 218691212
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3565
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3492585..3493493 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDB7N048
KEGG IDecq:ECED1_3565
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 4.9e-107, Aligned region: 14..291
Protein Sequence: 302 a.a.     [Download]
>gi|218691212|ref|YP_002399424.1| hypothetical protein ECED1_3565 [Escherichia coli ED1a]
MKAGIVCSLLRPAVMMMSLSVLSLTAQADELMKWERIPLNILLKVGQERVIFADKNVRVGFPPALNGKLR
VQSTGGAVYLKADSAFPQTRVQLQDVESGEMILLDVTAGEKGTTEPVRIVYDGDVSTVSRAAGSDVQTVK
SRSSNGKAGMDNGTQARRTEPRYAELLPVLLTRYAAQSLYAPLRTLEPVAGIRPVVPHLPRQITTVYPSE
PLTVSPVAAWAAGGRTVVALKLTSTVSRRIVLDPRALQGRFVAATFQHRWLGAAGTPEDTTMLYVVTAGS
PEKAFVEEPVTSRRGGEVTHAD
 
Nucleotide Sequence: 909 bp     [Download]
>ref|NC_011745.1|:c3493493-3492585 hypothetical protein ECED1_3565 [Escherichia coli ED1a]
ATGAAAGCCGGCATTGTGTGCAGTCTGCTGCGTCCTGCCGTCATGATGATGTCGTTGTCAGTGCTGAGTC
TGACGGCACAGGCGGATGAACTGATGAAGTGGGAGCGTATACCGCTGAATATCCTGCTGAAGGTGGGGCA
GGAGCGGGTGATTTTTGCGGATAAAAATGTGCGGGTGGGCTTCCCTCCGGCGCTGAATGGAAAACTGCGG
GTCCAGAGTACCGGTGGTGCGGTCTACCTGAAGGCAGACAGTGCATTTCCGCAGACCCGGGTTCAGCTGC
AGGATGTGGAAAGCGGGGAAATGATCCTGCTGGATGTCACTGCGGGGGAAAAGGGAACCACGGAGCCCGT
GCGTATCGTGTATGACGGAGACGTGAGTACGGTCAGCCGTGCTGCCGGGAGTGATGTACAGACTGTGAAA
AGTCGCAGCAGCAACGGGAAGGCGGGGATGGATAATGGTACTCAGGCCCGTCGCACGGAGCCCCGTTATG
CTGAGCTCCTGCCGGTGCTGTTGACCCGGTATGCGGCACAGTCCCTGTATGCACCACTGCGCACCCTTGA
ACCGGTGGCGGGGATCAGACCGGTGGTGCCACATCTTCCCCGGCAGATCACCACGGTTTATCCGTCAGAG
CCGCTGACTGTTTCACCGGTGGCGGCATGGGCAGCCGGTGGCCGGACGGTGGTGGCCCTGAAACTCACCA
GTACGGTAAGCAGGCGTATTGTGCTTGATCCCCGGGCCCTTCAGGGGCGTTTTGTGGCGGCGACTTTCCA
GCATCGCTGGCTGGGTGCTGCCGGTACGCCGGAAGATACCACGATGCTGTATGTGGTGACGGCGGGCAGT
CCGGAGAAGGCGTTTGTGGAAGAGCCTGTAACGTCCCGCAGGGGCGGGGAGGTGACGCATGCAGATTAA
 Primer design