SecReT4
Protein ID: 218691213
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3566
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3493490..3494137 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDB7MZQ4
KEGG IDecq:ECED1_3566
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.3e-87, Aligned region: 5..207
Protein Sequence: 215 a.a.     [Download]
>gi|218691213|ref|YP_002399425.1| hypothetical protein ECED1_3566 [Escherichia coli ED1a]
MSRFRHALKDRDQHILTLRVFSGVLCGLLLMVTIGWMTAPDRLTIHNPPDLRSGSTRPWWEVPPSTVYSF
AFYIFQQLNAWPKNGEVDYPAKIHALSAYLTPSCREILETDARRRKDAGELLDRVRVVYEIPEHGYGGRY
NRDPVTVEGRDNWLVRLDLVADEYFHAEPVKRALIRYPMKVMRMEGDPERNPFGLVLDCYSSTPQRLEAV
KGGGE
 
Nucleotide Sequence: 648 bp     [Download]
>ref|NC_011745.1|:c3494137-3493490 hypothetical protein ECED1_3566 [Escherichia coli ED1a]
ATGAGCCGTTTTCGTCATGCCCTGAAGGATCGTGATCAGCATATTCTGACGCTGAGGGTGTTCAGCGGTG
TGCTGTGCGGACTTCTTCTTATGGTCACTATCGGGTGGATGACGGCCCCTGACCGGCTGACCATTCATAA
TCCGCCGGATCTGCGTTCCGGCAGTACGCGTCCGTGGTGGGAAGTTCCTCCGTCAACGGTCTATTCCTTT
GCGTTCTACATTTTTCAGCAACTGAATGCCTGGCCGAAAAATGGCGAGGTGGATTATCCGGCGAAAATAC
ATGCACTGTCGGCCTATCTGACACCGTCATGCCGGGAGATCCTGGAGACGGATGCCCGTCGTCGTAAGGA
TGCAGGAGAGCTGCTGGATCGTGTTCGTGTGGTGTATGAGATCCCTGAGCACGGTTACGGCGGACGTTAC
AACCGTGACCCGGTCACGGTGGAGGGGCGGGACAACTGGCTTGTCCGTCTCGACCTGGTGGCGGATGAGT
ATTTTCATGCAGAGCCGGTCAAACGGGCACTGATCCGCTATCCGATGAAAGTGATGCGGATGGAGGGCGA
TCCGGAGCGTAATCCGTTTGGTCTTGTGCTGGACTGCTACAGCTCCACGCCACAGCGTCTGGAAGCCGTG
AAGGGAGGTGGTGAATGA
 Primer design