SecReT4
Protein ID: 218691214
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3567
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3494134..3494511 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDB7N050
KEGG IDecq:ECED1_3567
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3e-42, Aligned region: 6..121
Protein Sequence: 125 a.a.     [Download]
>gi|218691214|ref|YP_002399426.1| hypothetical protein ECED1_3567 [Escherichia coli ED1a]
MELVMETIRFLPDRLNAEPTVFRGFTTPELGLAALTGFFTGLLWSLPFVPVFGWVTIPTGALLTPLVLVW
TGGAWISRLKRGKPDNWLWQRLEEKKAALGVGRSGLIREAQGWSLRRTRVRGGKS
 
Nucleotide Sequence: 378 bp     [Download]
>ref|NC_011745.1|:c3494511-3494134 hypothetical protein ECED1_3567 [Escherichia coli ED1a]
GTGGAGCTGGTTATGGAGACCATTCGTTTTCTGCCCGATCGTCTGAACGCCGAACCGACGGTGTTCAGGG
GGTTCACCACCCCGGAACTGGGGCTGGCTGCACTGACCGGGTTCTTCACCGGTCTGCTGTGGTCACTTCC
TTTTGTGCCGGTGTTCGGGTGGGTGACTATACCCACTGGCGCCCTGCTGACCCCGCTGGTTCTTGTCTGG
ACCGGGGGGGCATGGATCAGCCGTCTGAAGCGGGGGAAACCGGATAACTGGCTATGGCAGCGTCTTGAGG
AGAAAAAAGCGGCGCTGGGAGTGGGACGCTCCGGGCTTATCAGGGAGGCCCAGGGCTGGTCCCTGCGCCG
TACCCGTGTCAGAGGGGGTAAATCATGA
 Primer design