SecReT4
Protein ID: 218691215
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3568
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3494518..3494895 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDB7N051
KEGG IDecq:ECED1_3568
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 5.2e-34, Aligned region: 37..123
Protein Sequence: 125 a.a.     [Download]
>gi|218691215|ref|YP_002399427.1| hypothetical protein ECED1_3568 [Escherichia coli ED1a]
MRKKGLTVSRLRLMARLAGMVMVTFLLGSLTPALADLPQIEPPSSGGGGGLFGQIKGYFQDGIVLIGLVI
AAAAFVKVAEAAITTFSEVRDDKKGWGQFGAIVVVGVVLLVAVIWLLGKSASIIL
 
Nucleotide Sequence: 378 bp     [Download]
>ref|NC_011745.1|:c3494895-3494518 hypothetical protein ECED1_3568 [Escherichia coli ED1a]
ATGCGTAAAAAAGGGCTTACTGTCAGCCGTCTGCGCCTGATGGCGCGTCTGGCGGGAATGGTCATGGTGA
CGTTTTTGCTGGGTAGTCTGACACCGGCACTGGCCGATCTGCCGCAGATTGAACCGCCGTCGTCCGGTGG
TGGTGGCGGACTTTTCGGGCAAATCAAAGGTTATTTCCAGGATGGCATTGTGCTGATTGGTCTGGTGATC
GCCGCGGCTGCCTTTGTGAAAGTGGCAGAGGCTGCGATTACCACCTTTTCTGAAGTCCGTGATGACAAGA
AAGGCTGGGGGCAGTTCGGGGCCATTGTCGTGGTGGGGGTGGTACTGCTGGTTGCGGTCATCTGGCTGCT
TGGTAAATCCGCGTCCATCATCCTGTAA
 Primer design