SecReT4
Protein ID: 218691217
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3570
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3495168..3495530 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDB7N053
KEGG IDecq:ECED1_3570
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.2e-30, Aligned region: 36..115
Protein Sequence: 120 a.a.     [Download]
>gi|218691217|ref|YP_002399429.1| hypothetical protein ECED1_3570 [Escherichia coli ED1a]
MILTEVCMFSLPALSRKTAGLTGTAGMMLLVTLVLPVQAAEKDELATVMRQLDQVRAALDRARTASLQAT
PHDGRYFFDYPRAQADIQTMQEGIDRYLTPSRAQPRNGSAVTGEYRRERP
 
Nucleotide Sequence: 363 bp     [Download]
>ref|NC_011745.1|:c3495530-3495168 hypothetical protein ECED1_3570 [Escherichia coli ED1a]
TTGATTCTGACGGAGGTGTGTATGTTTTCTCTTCCTGCATTATCCCGGAAAACGGCCGGTCTGACGGGGA
CCGCCGGGATGATGCTTCTCGTGACCCTGGTTCTGCCCGTTCAGGCCGCTGAAAAGGATGAGCTGGCGAC
GGTCATGCGCCAGCTTGATCAGGTCCGTGCGGCGCTTGATCGGGCCAGAACGGCGTCCCTTCAGGCCACG
CCCCATGACGGGCGTTATTTTTTCGACTATCCGCGTGCTCAGGCTGACATTCAGACCATGCAGGAGGGGA
TCGACCGTTATCTCACGCCCTCCCGGGCGCAACCACGTAACGGTAGTGCCGTGACCGGTGAATACCGGCG
GGAGCGTCCCTGA
 Primer design