SecReT4
Protein ID: 218691220
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3573
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3496643..3497410 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDB7N056
KEGG IDecq:ECED1_3573
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 4.6e-69, Aligned region: 54..252
Protein Sequence: 255 a.a.     [Download]
>gi|218691220|ref|YP_002399432.1| hypothetical protein ECED1_3573 [Escherichia coli ED1a]
MTMAEARRDAERSPQSRPPRQHGLLYNLVWGWPWALVGLLLSSLLLSLLIEYAGMTFFWPDEGAAHSRAV
MNTELGWLSTEFTRSLLLSTPSVTVPGWISVAYQWLFVESGMQSWLQSQQAVTAAGRSVSQFSGELSQWL
AYHLHDYLLATVYVAVVTMVRVIILVLSVPLFVMVILVAVVEGLGRRDLRRYGAAYESSFVYHHAKKSIK
PAIYIPCILYLSWPTAVYPNLLIWPAAMLLGMAVTVTMASFKKYL
 
Nucleotide Sequence: 768 bp     [Download]
>ref|NC_011745.1|:c3497410-3496643 hypothetical protein ECED1_3573 [Escherichia coli ED1a]
GTGACCATGGCGGAAGCACGTCGTGATGCAGAACGCAGTCCGCAGTCCCGCCCTCCCCGTCAGCATGGGT
TGCTGTACAATCTGGTGTGGGGCTGGCCATGGGCTCTGGTGGGGCTGCTCCTCTCCTCACTGTTACTGAG
TCTGCTGATTGAGTATGCAGGTATGACGTTTTTCTGGCCTGATGAGGGGGCGGCACACAGTCGTGCCGTC
ATGAATACAGAGCTGGGCTGGCTGTCGACGGAGTTCACGCGCAGCCTGCTGCTGTCCACGCCGTCAGTGA
CGGTACCGGGCTGGATTTCCGTGGCGTATCAGTGGCTGTTTGTGGAAAGTGGTATGCAGTCATGGCTGCA
GTCGCAGCAGGCGGTAACGGCGGCGGGGCGGAGTGTATCGCAGTTCAGCGGAGAGCTGAGCCAGTGGCTG
GCATATCATCTTCATGATTACCTGCTGGCAACGGTTTATGTGGCGGTGGTGACGATGGTCAGGGTGATTA
TTCTCGTGCTGTCCGTGCCACTGTTCGTGATGGTGATCCTGGTGGCCGTGGTTGAGGGGCTGGGCAGACG
TGATCTGCGCCGGTATGGTGCCGCATATGAATCCAGCTTTGTTTATCACCATGCGAAAAAGTCTATTAAA
CCGGCGATATATATTCCCTGTATTCTCTATCTTTCCTGGCCGACGGCCGTGTACCCGAATCTGCTGATAT
GGCCGGCGGCCATGCTGCTGGGTATGGCTGTCACCGTGACAATGGCATCCTTCAAGAAATATTTATAA
 Primer design