SecReT4
Protein ID: 218691224
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3577
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3500896..3501426 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDB7N060
KEGG IDecq:ECED1_3577
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 2.3e-46, Aligned region: 29..171
Protein Sequence: 176 a.a.     [Download]
>gi|218691224|ref|YP_002399436.1| hypothetical protein ECED1_3577 [Escherichia coli ED1a]
MIPVKRYVMTAVWPLLLCASQAGAELRVIADLGGSDASVFYEAINRQDGSSTPPPVTAPLPAQGETLVLP
VTTPEMTPGEVTPRPLQLPGIGALFLVGDDALSRQWLKANAAALRERQAVGMVVSVADENSLKTLRELAP
GVMMVPSSGSALARRLQLNHWPVLITDSGISGVVTP
 
Nucleotide Sequence: 531 bp     [Download]
>ref|NC_011745.1|:c3501426-3500896 hypothetical protein ECED1_3577 [Escherichia coli ED1a]
GTGATACCTGTGAAACGATATGTAATGACGGCAGTGTGGCCCCTGCTGCTGTGCGCGTCTCAGGCTGGCG
CGGAACTCAGGGTTATTGCGGACCTTGGAGGCAGTGATGCCTCCGTGTTTTATGAGGCAATCAACCGACA
GGATGGGAGCAGTACGCCTCCCCCGGTTACGGCGCCTCTGCCGGCGCAGGGAGAGACGTTGGTGCTGCCC
GTGACCACGCCGGAAATGACGCCGGGTGAGGTGACGCCGCGACCACTGCAGTTGCCGGGGATCGGGGCGC
TGTTTCTGGTGGGAGATGATGCGCTTTCCCGTCAGTGGCTGAAGGCGAATGCGGCCGCTCTCCGTGAGCG
GCAGGCTGTCGGCATGGTTGTCAGCGTGGCGGATGAAAACAGCCTGAAAACGCTGCGTGAGCTGGCGCCC
GGCGTGATGATGGTGCCATCATCGGGGTCAGCGCTGGCACGCCGTCTGCAGCTGAATCACTGGCCGGTAC
TGATAACGGACAGCGGAATATCCGGGGTGGTGACACCGTGA
 Primer design