SecReT4
Protein ID: 218691225
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3578
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3501423..3502085 [-]
Productputative Lytic transglycosylase, catalytic
Component typeTfc4
UniProt IDB7MZR6
KEGG IDecq:ECED1_3578
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 220 a.a.     [Download]
>gi|218691225|ref|YP_002399437.1| putative Lytic transglycosylase, catalytic [Escherichia coli ED1a]
MARGSLLTMALLSMAVSSFCRAGEHDIPEGYVRVAAVHGVPAEVLYAVSLTETVMAPSAIAGVMKKRDAD
FRLPSVARPWPWTINVAGKGYRYASRLEAWQALQVFLTRYPARRIDVGIAQVNLGWNGHRFSSTWAAFDP
YISLNTAATILSECRRRHPVSWLQAAGCYHHPAGGAPAVRYTAVVRQHIERLHRDAVKTAEQHDGLTAMH
PRYIWTEPRE
 
Nucleotide Sequence: 663 bp     [Download]
>ref|NC_011745.1|:c3502085-3501423 putative Lytic transglycosylase, catalytic [Escherichia coli ED1a]
ATGGCGCGTGGCAGCCTTCTGACAATGGCGCTGTTGAGCATGGCTGTCAGCAGTTTCTGCCGGGCGGGGG
AGCATGATATCCCTGAGGGGTATGTGCGCGTGGCTGCCGTGCATGGTGTGCCTGCAGAAGTGCTCTATGC
CGTCTCTCTGACAGAGACGGTGATGGCGCCCTCTGCGATTGCCGGTGTGATGAAAAAACGGGATGCGGAT
TTCCGCCTCCCGTCCGTTGCACGTCCCTGGCCGTGGACCATCAATGTGGCTGGTAAGGGCTACCGCTATG
CCAGTCGCCTGGAAGCCTGGCAGGCACTTCAGGTTTTTCTGACACGGTATCCGGCCCGGCGGATTGACGT
GGGAATTGCTCAGGTCAATCTGGGCTGGAACGGGCACCGTTTCTCCTCCACATGGGCGGCATTTGATCCG
TACATCAGTCTGAACACCGCGGCGACCATCCTGAGTGAATGCCGTCGTCGTCATCCTGTCAGCTGGCTGC
AGGCGGCCGGTTGTTATCATCATCCGGCAGGTGGTGCTCCGGCAGTACGCTACACCGCAGTGGTCAGACA
ACATATTGAGCGTCTTCATCGTGATGCGGTGAAGACCGCAGAGCAGCATGACGGCCTGACCGCCATGCAT
CCCCGTTATATCTGGACAGAACCCCGGGAGTGA
 Primer design