SecReT4
Protein ID: 218691226
T4SS name [ID]Tfc [688]
Gene symbol-
Locus tagECED1_3579
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T4SS(s) in this replicon]
Location [Strand]3502064..3502786 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDB7N062
KEGG IDecq:ECED1_3579
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 240 a.a.     [Download]
>gi|218691226|ref|YP_002399438.1| hypothetical protein ECED1_3579 [Escherichia coli ED1a]
MKMKNLSPVLMLLISLQTVAAVRESAPEGTRTQASSQVSTTTQALQQQAAQWGVTEEDYRRYRALMEGPR
GIQSPGLDPLTVLGIEARTDAERRQLAEKWVKAEYERTEKELAFQREVNAAWKRLYPGVMPVSLGKGGGL
LNDNGGRLALFVKAKDCGTCDARLASVLSSGRQVDIYLVDSQGSDNLLRQWALEHDIPVDRVRSRHITLN
HDAGRWLRFGEGRMPVVLQQGADGWRVAAF
 
Nucleotide Sequence: 723 bp     [Download]
>ref|NC_011745.1|:c3502786-3502064 hypothetical protein ECED1_3579 [Escherichia coli ED1a]
ATGAAAATGAAGAATCTGTCACCGGTGCTCATGCTGCTCATTTCCCTGCAGACGGTGGCTGCCGTACGGG
AGAGTGCGCCTGAGGGCACACGCACGCAGGCCTCTTCGCAGGTCAGTACCACCACACAGGCGCTGCAGCA
ACAGGCCGCTCAGTGGGGAGTCACTGAGGAGGATTACCGTCGATACCGGGCTCTGATGGAGGGACCGCGG
GGGATTCAGTCCCCCGGTCTGGATCCGCTGACGGTGCTGGGGATTGAAGCACGGACGGATGCGGAACGCC
GGCAGCTGGCTGAAAAATGGGTGAAGGCCGAATATGAGCGGACTGAGAAGGAACTGGCATTTCAGCGGGA
AGTCAATGCGGCCTGGAAACGCCTTTATCCGGGCGTTATGCCGGTCAGCCTGGGGAAAGGGGGCGGGCTG
CTAAACGACAACGGCGGGCGGCTGGCGTTGTTTGTGAAAGCGAAAGACTGTGGAACCTGTGATGCACGAC
TGGCATCAGTGTTGTCTTCGGGGCGGCAGGTGGATATTTACCTGGTTGACAGTCAGGGCAGTGACAATCT
GCTGCGGCAGTGGGCACTGGAGCACGATATCCCTGTGGACCGGGTGCGAAGCCGCCATATTACCCTGAAT
CATGATGCCGGTCGCTGGCTGCGTTTTGGTGAAGGCAGAATGCCGGTTGTACTGCAGCAGGGAGCGGACG
GATGGCGCGTGGCAGCCTTCTGA
 Primer design