SecReT4
Protein ID: 218692863
T4SS name [ID]Tra_F [88]
Gene symboltraX
Locus tagp1ECUMN_0077
StrainEscherichia coli UMN026
Repliconplasmid p1ESCUM [GenBank: NC_011749] [Browse all T4SS(s) in this replicon]
Location [Strand]56192..57409 [-]
ProductF pilin acetylase
Component typeTraX_F
UniProt IDB7LJ25
KEGG IDeum:p1ECUMN_0077
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.7e-52, Aligned region: 189..404
Protein Sequence: 405 a.a.     [Download]
>gi|218692863|ref|YP_002405975.1| F pilin acetylase [Escherichia coli UMN026]
MPVKVVRGIPVPSPVAACGGISRITASSRGPEMANRSRQRYWHSGRLKRPSAVKRNAAQMKLSGKWQRTN
LTCRMAKQSWLSGILPDRSVTGLPYLNGKPHCRRVCCVNHNGSGKRSGRLPGKICCRSVCSRWSGIWFVT
CRKRKPWAETDTGRQTLMTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIF
QLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVA
AQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERLALLACLLAVIPAL
NLASSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 1218 bp     [Download]
>ref|NC_011749.1|:c57409-56192 F pilin acetylase [Escherichia coli UMN026]
TTGCCGGTGAAGGTCGTCCGTGGAATCCCGGTGCCATCACCGGTGGCCGCGTGTGGGGGGATATCCCGGA
TAACAGCGTCCAGCCGGGGGCCGGAAATGGCGAACCGGTCACGGCAGAGGTACTGGCACAGCGGCAGGCT
GAAGAGGCCATCCGCCGTGAAACGGAACGCCGCGCAGATGAAATTGTCAGGAAAATGGCAGAGAACAAAC
CTGACCTGCCGGATGGCAAAACAGAGCTGGCTGTCAGGGATATTGCCGGACAGGAGCGTGACCGGTCTGC
CATATCTGAACGGGAAACCGCACTGCCGGAGAGTGTGCTGCGTGAATCACAACGGGAGCGGGAAGCGGTC
CGGGAGGTTGCCCGGGAAAATCTGCTGCAGGAGCGTCTGCAGCAGATGGAGCGGGATATGGTTCGTGACC
TGCAGAAAGAGAAAACCCTGGGCGGAGACTGATACAGGAAGACAAACACTGATGACAACGGATAACACGA
ACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGTCGTTTCTGGTCTGGTCACC
CGGACAGCGGGATATCATCAAAACGGTGGCGCTGGTGCTGATGGTACTGGACCACATCAATCTGATATTC
CAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTGTTTGCCCTGGTGTGGGGGC
TGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGTGGGGATGGGGAATTATTGC
CCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCTGTTTGCCTTTGCAGTGGCG
GCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCGGCCATTCTTCTGATGGCCC
TGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGCTGGCGGTCAGTTACCGACT
GTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGCTTGCATGCCTGCTGGCCGTTATTCCGGCACTT
AACCTTGCCTCCAGTGATGCAGCGGCGGTGGCCGGTCTTGTAATGACGGTGCTGACCGTTGGTCTGGTGT
CGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGGTATTCTACGCCTGTCATCT
GGCTGTGCTGGGCGTTCTGGCGTTGTGA
 Primer design