SecReT4
Protein ID: 218692874
T4SS name [ID]Tra_F [88]
Gene symbolTraQ
Locus tagp1ECUMN_0088
StrainEscherichia coli UMN026
Repliconplasmid p1ESCUM [GenBank: NC_011749] [Browse all T4SS(s) in this replicon]
Location [Strand]72158..72442 [-]
Productconjugal transfer protein TraQ
Component typeTraQ_F
UniProt IDB7LJ36
KEGG IDeum:p1ECUMN_0088
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.4e-49, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|218692874|ref|YP_002405986.1| conjugal transfer protein TraQ [Escherichia coli UMN026]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>ref|NC_011749.1|:c72442-72158 conjugal transfer protein TraQ [Escherichia coli UMN026]
ATGATAAGTAAACGCAGATTCTCTTTACCACGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design