SecReT4
Protein ID: 218692875
T4SS name [ID]Tra_F [88]
Gene symboltraF
Locus tagp1ECUMN_0090
StrainEscherichia coli UMN026
Repliconplasmid p1ESCUM [GenBank: NC_011749] [Browse all T4SS(s) in this replicon]
Location [Strand]73194..73967 [-]
Productconjugal transfer protein TraF
Component typeTraF_F
UniProt IDB7LJ37
KEGG IDeum:p1ECUMN_0090
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.2e-78, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|218692875|ref|YP_002405987.1| conjugal transfer protein TraF [Escherichia coli UMN026]
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLTALQT
ATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQ
AQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQR
LGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 774 bp     [Download]
>ref|NC_011749.1|:c73967-73194 conjugal transfer protein TraF [Escherichia coli UMN026]
ATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTA
TTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGA
AAATAAACCAGTACCTGCAGCCCCCCGTCAGGAGCCGGACATTATGCAGAAACTGACCGCGCTGCAGACG
GCAACAAAGCGGGCGCTGTACGAAGCTATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGC
TGCAGAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAAAAAAGCCATGCTGGCGCATCC
CGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTCCGGAACCAGCTGGCGGCAGACCAG
GCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGG
ACCCCATCGACGGGCAGCTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCC
CGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGC
CTCGGTGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCAT
ACGGCTTTATTTCACAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAATTT
TTAA
 Primer design