SecReT4
Protein ID: 218692895
T4SS name [ID]Tra_F [88]
Gene symboltraL
Locus tagp1ECUMN_0110
StrainEscherichia coli UMN026
Repliconplasmid p1ESCUM [GenBank: NC_011749] [Browse all T4SS(s) in this replicon]
Location [Strand]87535..87846 [-]
Productconjugal transfer protein TraL
Component typeTraL_F
UniProt IDB7LJ57
KEGG IDeum:p1ECUMN_0110
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.2e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|218692895|ref|YP_002406007.1| conjugal transfer protein TraL [Escherichia coli UMN026]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGIITSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>ref|NC_011749.1|:c87846-87535 conjugal transfer protein TraL [Escherichia coli UMN026]
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCATAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design