SecReT4
Protein ID: 218705483
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2284
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2312196..2312924 [+]
Productputative type IV secretory pathway VirB1 component
Component typeVirB1
UniProt IDB7NBY3
KEGG IDeum:ECUMN_2284
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 7.9e-21, Aligned region: 15..148
Protein Sequence: 242 a.a.     [Download]
>gi|218705483|ref|YP_002413002.1| putative type IV secretory pathway VirB1 component [Escherichia coli UMN026]
MFTEVTMLSTTAFLAIAMQCAASIHPSTAFDVARVESGFNPYAIAEIVPKAGPSFGDQHIISHLPASRGD
AEHILRRLTAQDRRYSVGLMQITSTNFRHYGVSATELLDPCTNLSVFEHILRDCYRRGGTLKRALSCYYS
GNFSTGQQPETAFSGTSYIQRIGYPPGSSRYAVPGTREDKSSVAVPLKTAPASDSSRHHEIWPGVVVRGV
PAKLRQEKIFIAPFSAPSVRRSFSLSPREEEE
 
Nucleotide Sequence: 729 bp     [Download]
>ref|NC_011751.1|:2312196-2312924 putative type IV secretory pathway VirB1 component [Escherichia coli UMN026]
TTGTTTACTGAGGTCACCATGCTTTCCACCACAGCCTTTCTGGCGATAGCCATGCAGTGCGCCGCCAGCA
TTCATCCGTCCACGGCATTCGACGTGGCACGGGTGGAATCCGGTTTTAACCCTTATGCCATCGCTGAGAT
TGTCCCGAAGGCCGGCCCCTCTTTCGGCGATCAACACATTATTTCTCACCTGCCAGCCAGCCGGGGAGAT
GCAGAGCATATTCTCCGCCGCCTGACAGCACAGGATCGCCGTTACTCTGTCGGGCTGATGCAAATCACCA
GCACCAATTTCCGCCATTATGGTGTGTCCGCCACAGAGCTACTTGATCCCTGTACCAATCTGTCCGTCTT
CGAACACATTCTCAGAGACTGCTACCGGCGCGGCGGCACGCTGAAAAGGGCGCTGAGTTGTTATTATTCC
GGCAATTTCAGTACCGGGCAACAACCTGAAACGGCGTTTTCCGGAACGAGCTATATCCAGCGAATCGGTT
ATCCGCCGGGATCATCCCGCTATGCGGTCCCCGGAACCCGTGAGGACAAATCATCAGTTGCCGTTCCCCT
GAAAACCGCCCCTGCCAGTGACTCATCCCGTCACCACGAGATCTGGCCCGGAGTCGTCGTCCGTGGCGTC
CCTGCGAAACTCCGCCAAGAAAAAATCTTCATCGCACCGTTCTCCGCGCCGTCAGTGCGCCGGAGTTTCT
CCCTGTCACCCCGTGAGGAGGAGGAATAA
 Primer design