SecReT4
Protein ID: 218705485
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2286
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2313230..2315968 [+]
Productputative type IV secretory pathway VirB4 component
Component typeVirB4
UniProt IDB7NBY5
KEGG IDeum:ECUMN_2286
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.6e-47, Aligned region: 269..470
AAA_10 [PF12846], Evalue: 1.5e-23, Aligned region: 533..824
VirB3 [PF05101], Evalue: 8e-09, Aligned region: 4..81
Protein Sequence: 912 a.a.     [Download]
>gi|218705485|ref|YP_002413004.1| putative type IV secretory pathway VirB4 component [Escherichia coli UMN026]
MAKLLKAMKRPAALWGVPMVPLLAVTGVTIIVAVWTSVALLFLLPVEFLVMKSLTRNEPMRFNLIAVWLR
VKGKPVANRLFGATTLMPVEHEAVDIKEFLDAMKLNQCATIKKYIPYSSHIHQHVVRSPKSDLYCTWELM
GTPFDCESDESLQFGTNQLHGLIHSFEGMPVTFYIHNDRNTFTDNLHKDSGNPYADEVSRLYYASVGVFR
RNRLFLTVCYRPFVSLEKAERKRMKDSQKLKELDGALLEMLEIKSTLDTALSRYGARPLGTFTEGSAVFS
SQLAFYEYLLTHQWRKVRVTRTPAYDVMGAAALFFSAESGQINHANGTQYFRGLEVKEFSEETATGMMDS
LLYAPCDYVITQSYTCMSREEAKKAIKRTRRLLMSADDDAVSQRLDLDVALDLLTSGKIAYGKHHFSIMV
YSPSLENLVADTNEISNALNNIGITPVPAEISLSAAYMAQLPGNYNLRPRKGELSSQNFVELAALHNFYP
GKRDKAPWGDAMALLRTPSGDGYYINLHNTLADKDEFNEKNPASTCILGTNGSGKTMLMTFFEIMQQKYG
REDSFSPDAKTKRLTTVYLDKDRGAEMNIRALGGRYYRVISGESTGWNPFSLPATKRNINFIKQLMKILC
TRNGSTIFPRDERRLSDAVNAVMNDEPQYRVYGITRMLENLPEPATKEAQENGLSIRLSQWAQGGEFGWV
FDNESDTFDISNCDNFGIDGTEFLDDASVCAPISFYLLYRITSLLDGRRLVIFMDEFWKWLRDPVFKDFA
YNKLKTIRKLNGMLVVGTQSPAEIIKDDIAPAVIEQCGTQILAANPNADRAHYVDDMKFEPEVFDVVKGL
DPQARQYVVVKNQFKRGDTKRFAARVTLDLSGIGRYTKVMSGDAPNLEIFESIYREGMQPHEWLDTYLAK
AL
 
Nucleotide Sequence: 2739 bp     [Download]
>ref|NC_011751.1|:2313230-2315968 putative type IV secretory pathway VirB4 component [Escherichia coli UMN026]
ATGGCAAAGCTGCTCAAGGCAATGAAACGCCCGGCGGCGCTGTGGGGGGTGCCTATGGTGCCCCTGCTGG
CTGTCACGGGTGTAACCATCATCGTTGCTGTCTGGACTTCCGTCGCACTCCTGTTCTTACTTCCCGTCGA
ATTTCTGGTGATGAAATCCCTCACCAGAAATGAACCAATGCGGTTCAATCTGATTGCCGTTTGGCTGAGA
GTGAAGGGAAAACCGGTAGCAAACCGTTTATTTGGCGCAACAACACTTATGCCCGTTGAGCATGAGGCTG
TTGATATCAAGGAGTTTCTCGACGCCATGAAACTAAATCAGTGTGCCACCATCAAGAAGTATATTCCGTA
CTCATCGCACATTCATCAGCATGTGGTTCGCTCACCTAAAAGCGATCTGTACTGCACCTGGGAATTGATG
GGAACGCCGTTCGACTGCGAGTCTGACGAATCACTCCAGTTCGGGACGAACCAGTTACACGGGCTAATCC
ACTCATTCGAAGGTATGCCCGTCACTTTCTATATCCATAACGACCGCAATACGTTTACCGACAATCTTCA
TAAAGATTCCGGCAACCCGTATGCCGATGAAGTTAGCCGTCTTTACTACGCTTCTGTCGGGGTGTTCCGG
CGTAACCGCCTGTTCCTGACAGTCTGCTATCGCCCGTTTGTCAGCCTTGAAAAAGCAGAACGCAAACGGA
TGAAAGACAGCCAGAAACTAAAGGAACTGGACGGTGCTTTGCTGGAAATGCTGGAAATAAAAAGCACGCT
CGATACCGCGCTGTCGCGCTATGGTGCGCGGCCTCTCGGTACGTTTACCGAAGGAAGCGCGGTGTTTTCG
TCGCAACTGGCTTTCTATGAATATCTGTTAACGCACCAGTGGCGAAAGGTGCGCGTCACCCGCACCCCGG
CCTATGACGTGATGGGAGCGGCGGCGTTGTTCTTTTCGGCTGAATCCGGGCAGATAAACCACGCCAACGG
TACGCAATATTTCCGGGGGCTGGAGGTTAAAGAGTTCTCCGAAGAAACCGCCACGGGGATGATGGACTCC
CTTCTTTATGCCCCCTGCGATTACGTGATCACGCAGTCCTATACCTGCATGTCACGCGAGGAAGCGAAGA
AAGCCATTAAGCGTACCCGTCGCCTTTTGATGAGTGCCGATGACGATGCTGTTTCCCAGCGGCTGGATCT
GGATGTGGCGCTTGACCTGCTGACATCGGGGAAAATCGCTTACGGAAAGCACCATTTTTCCATCATGGTG
TATTCCCCGTCGCTGGAAAACCTAGTGGCTGATACTAACGAAATCAGTAATGCGCTGAACAACATCGGGA
TAACGCCTGTTCCGGCAGAAATATCGCTTTCAGCGGCGTATATGGCGCAACTGCCAGGCAACTACAACCT
GCGGCCACGTAAAGGGGAGCTAAGTAGCCAAAACTTTGTGGAGCTGGCCGCACTCCATAATTTCTATCCG
GGCAAGCGCGATAAAGCCCCCTGGGGGGATGCTATGGCTTTACTGCGCACCCCGTCAGGAGATGGCTACT
ATATCAACCTGCATAACACACTGGCAGATAAGGACGAATTCAACGAAAAGAACCCGGCCAGTACCTGCAT
CCTCGGTACGAACGGTTCGGGTAAAACCATGTTGATGACGTTCTTTGAGATCATGCAGCAGAAATACGGG
CGTGAGGATAGCTTCTCCCCGGATGCCAAAACCAAACGGCTGACAACCGTTTACCTCGATAAAGACCGGG
GCGCAGAGATGAACATCCGGGCGCTGGGTGGCCGTTACTATCGGGTTATCAGTGGTGAGTCTACAGGGTG
GAACCCGTTCTCGTTGCCAGCAACCAAACGCAATATCAATTTCATCAAGCAACTGATGAAAATCCTTTGT
ACCCGCAACGGCTCGACGATCTTCCCACGCGATGAACGCCGTCTGAGTGATGCGGTTAATGCTGTGATGA
ATGACGAGCCACAATATCGCGTCTACGGCATTACCCGAATGCTGGAGAATTTGCCTGAGCCGGCTACGAA
AGAAGCCCAGGAAAACGGCCTTAGCATTCGGTTGTCACAGTGGGCGCAGGGCGGTGAGTTCGGCTGGGTG
TTTGATAACGAGTCTGACACGTTCGATATCAGCAACTGCGATAACTTCGGCATCGACGGAACGGAGTTCC
TGGACGATGCAAGCGTATGTGCGCCAATCTCGTTTTATCTGCTGTACCGCATTACCAGCCTGCTTGACGG
GCGACGCCTGGTCATTTTCATGGATGAATTCTGGAAGTGGTTACGCGACCCGGTGTTTAAGGACTTTGCT
TATAACAAGCTGAAAACCATCCGTAAGCTGAACGGGATGCTGGTCGTCGGCACTCAATCCCCGGCTGAGA
TCATCAAAGATGATATCGCCCCGGCAGTGATTGAGCAGTGCGGGACACAGATTCTGGCGGCGAACCCCAA
CGCCGACCGCGCACATTATGTTGACGACATGAAGTTTGAACCGGAAGTGTTCGACGTGGTGAAAGGGCTT
GACCCGCAAGCCCGCCAGTATGTTGTGGTGAAAAATCAGTTCAAGCGCGGCGATACCAAACGTTTTGCCG
CTCGTGTCACGCTAGACCTGTCGGGTATCGGCAGATATACCAAAGTCATGAGCGGCGATGCCCCCAACCT
CGAAATATTCGAATCGATTTACCGGGAAGGAATGCAGCCTCATGAATGGCTCGATACCTACCTGGCTAAA
GCACTCTGA
 Primer design