SecReT4
Protein ID: 218705486
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2287
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2315987..2316700 [+]
Productputative type IV secretory pathway VirB5 component
Component typeVirB5
UniProt IDB7NBY6
KEGG IDeum:ECUMN_2287
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.7e-39, Aligned region: 23..218
Protein Sequence: 237 a.a.     [Download]
>gi|218705486|ref|YP_002413005.1| putative type IV secretory pathway VirB5 component [Escherichia coli UMN026]
MKTHFYALIFACSLASPLAQAGGILVFDATAKLENVRQWQKEAKQWMETAQHYKDQIRAYKDQLATATGV
RDIASFVDQAKSLKADLEKLRKPGQALNDLLLSGGSSGQFDALYEKYKIFDTCKAERSESYANVCKQQVI
NKAIQLEQTDEIQNQVSQALGEINSLSNRVALAKDSKESQDLANSIQLKSVMLNTLTTQWEMSVKAADKR
EKVLEAERVKQWNQQQLNAPTADLNNL
 
Nucleotide Sequence: 714 bp     [Download]
>ref|NC_011751.1|:2315987-2316700 putative type IV secretory pathway VirB5 component [Escherichia coli UMN026]
ATGAAAACTCACTTTTACGCGCTAATTTTCGCATGTTCGCTTGCAAGCCCTCTGGCACAAGCGGGAGGTA
TATTAGTATTTGATGCCACGGCCAAACTGGAAAATGTCCGCCAGTGGCAGAAAGAAGCGAAGCAATGGAT
GGAGACCGCACAACACTACAAAGACCAGATACGAGCTTATAAAGACCAACTGGCAACAGCCACAGGTGTT
CGAGATATCGCCAGCTTTGTTGACCAAGCCAAAAGCCTGAAAGCCGATCTCGAAAAACTACGCAAGCCGG
GACAGGCTCTGAATGATTTGCTTCTCTCCGGCGGCTCCTCCGGGCAGTTCGATGCGCTGTACGAAAAATA
TAAAATTTTTGATACCTGCAAAGCCGAACGCTCGGAGAGTTATGCCAACGTGTGCAAACAACAGGTCATC
AATAAAGCTATCCAGCTTGAGCAGACCGACGAGATCCAGAATCAGGTAAGCCAGGCCCTGGGAGAAATCA
ACAGCCTCTCCAACAGAGTTGCGCTAGCCAAAGATTCGAAAGAATCTCAAGACCTTGCAAACAGTATTCA
GCTAAAATCTGTCATGCTGAACACGCTTACCACTCAGTGGGAAATGAGTGTGAAAGCAGCAGATAAACGC
GAAAAAGTGCTTGAGGCGGAGCGCGTTAAACAGTGGAACCAACAGCAGTTAAACGCGCCAACTGCTGACC
TTAATAATTTATGA
 Primer design