SecReT4
Protein ID: 218705488
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2289
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2316954..2317298 [+]
Producttype IV secretory pathway VirB6 component (fragment)
Component typeVirB6
UniProt IDB7NBY8
KEGG IDeum:ECUMN_2289
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.3e-09, Aligned region: 40..79
Protein Sequence: 114 a.a.     [Download]
>gi|218705488|ref|YP_002413007.1| type IV secretory pathway VirB6 component (fragment) [Escherichia coli UMN026]
MSGGLFVGVEKYLIGGITDATKGLMMSYSSMMMGLAAASATIYIMWRGYQTLAGKLSTPMEDTMWDIMRM
AIILSFVAKEGANKRGNSSRLTQSFHFFMFEPIFSPVNALNQPI
 
Nucleotide Sequence: 345 bp     [Download]
>ref|NC_011751.1|:2316954-2317298 type IV secretory pathway VirB6 component (fragment) [Escherichia coli UMN026]
ATGAGTGGCGGTCTTTTTGTTGGGGTTGAGAAATACCTAATAGGAGGAATAACGGACGCCACAAAAGGAT
TAATGATGTCGTACTCTTCTATGATGATGGGGCTGGCAGCAGCGTCAGCTACCATCTACATCATGTGGCG
TGGATACCAGACTCTGGCTGGTAAGCTCTCTACGCCGATGGAAGACACGATGTGGGACATCATGAGGATG
GCGATCATCCTGTCCTTTGTAGCTAAGGAAGGTGCGAATAAGCGGGGAAATTCTTCTCGGCTGACTCAGT
CATTTCATTTCTTCATGTTTGAGCCGATTTTTTCTCCCGTAAATGCCTTGAATCAGCCTATTTAG
 Primer design