SecReT4
Protein ID: 218705490
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2291
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2318315..2319226 [+]
Producttype IV secretory pathway VirB6 component (fragment)
Component typeVirB6
UniProt IDB7NBZ0
KEGG IDeum:ECUMN_2291
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.8e-34, Aligned region: 25..205
Protein Sequence: 303 a.a.     [Download]
>gi|218705490|ref|YP_002413009.1| type IV secretory pathway VirB6 component (fragment) [Escherichia coli UMN026]
MMNPVPWLQMTNMISYQGLVRTFPNLGGYLDGVIDAINGIKEGFSGSDNIWQLLDTLWNKAKVLGKTLHD
MDDSTYIKDEGMTAQFYVWLGIFVLMIITAFVSMIAEVMILLLSITAPIFIFCLMYGFLRTMFNNWLQNI
FAAILTIMLSALSLRIVVNYLNLVLTKATKVADSSTIVELGAQVCLAGICAAILVYLSAKLAAALAGASA
TVSMQGLAAVGIGAAAFGAGKLAGGAIKETKRSTQDNIQGWKDANAGKPGKPGGELGYNASKARKYAIEQ
MIARNEARRLAQSRESAVKKFNS
 
Nucleotide Sequence: 912 bp     [Download]
>ref|NC_011751.1|:2318315-2319226 type IV secretory pathway VirB6 component (fragment) [Escherichia coli UMN026]
ATGATGAACCCTGTTCCATGGCTCCAGATGACAAACATGATCTCATATCAGGGACTTGTTCGCACCTTCC
CTAATTTAGGTGGCTACCTCGATGGCGTTATTGATGCCATAAACGGAATAAAGGAGGGTTTTTCTGGCAG
TGATAATATATGGCAGCTATTAGACACCTTATGGAATAAAGCAAAGGTGTTAGGTAAAACATTACACGAC
ATGGATGATTCCACTTATATAAAAGATGAGGGAATGACTGCTCAATTTTATGTCTGGCTTGGGATATTCG
TCTTAATGATTATCACCGCGTTTGTTTCCATGATAGCGGAAGTCATGATCTTATTACTGAGTATTACAGC
ACCTATATTTATTTTTTGCCTTATGTATGGTTTTCTCCGCACCATGTTCAATAACTGGCTACAAAATATA
TTTGCAGCCATATTAACCATTATGCTTTCAGCTCTTTCTTTAAGAATTGTAGTGAATTATTTAAACCTAG
TCCTTACCAAGGCAACGAAGGTCGCGGACAGTTCAACAATTGTTGAATTAGGAGCACAAGTCTGTCTTGC
GGGTATCTGTGCGGCAATATTGGTTTATCTCTCCGCAAAACTGGCCGCAGCACTGGCCGGGGCGAGTGCT
ACCGTATCCATGCAGGGGCTGGCCGCTGTAGGTATCGGTGCTGCTGCTTTTGGTGCCGGGAAGCTAGCCG
GAGGTGCAATTAAAGAAACCAAACGTTCCACCCAGGACAACATTCAGGGCTGGAAGGATGCGAATGCAGG
TAAGCCCGGCAAGCCTGGAGGTGAGTTAGGCTATAACGCTTCTAAAGCGCGTAAATACGCGATTGAGCAG
ATGATAGCCCGGAACGAAGCGCGGAGGCTGGCACAGTCGAGAGAATCCGCAGTTAAGAAGTTCAATAGCT
AA
 Primer design