SecReT4
Protein ID: 218705491
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2292
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2319444..2320127 [+]
Productputative type IV secretory pathway VirB8 component
Component typeVirB8
UniProt IDB7NBZ1
KEGG IDeum:ECUMN_2292
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.8e-51, Aligned region: 10..222
Protein Sequence: 227 a.a.     [Download]
>gi|218705491|ref|YP_002413010.1| putative type IV secretory pathway VirB8 component [Escherichia coli UMN026]
MNEQKLIAESRTFEQQMIDRDKRATKAGFVVGGVGLLIAVLALVAVVVMLPLKQTDVDLYTVDNHTGRVE
HVTRTSKTSLTATEAYQKAMAANYVKVRERYVYPSLQDDYETVQVYNAPQVNDDYLALYAGKNAPDKVYK
NGAHTVKVEILSNQITDGTAPDKVATVRYKKIIRRLADNSTRNEYWDARFTFHSDPDKDMSDAEREINYF
GFTVTSWQTDREIRGGE
 
Nucleotide Sequence: 684 bp     [Download]
>ref|NC_011751.1|:2319444-2320127 putative type IV secretory pathway VirB8 component [Escherichia coli UMN026]
ATGAATGAACAGAAATTAATTGCTGAATCCCGCACCTTTGAGCAGCAAATGATTGACCGGGATAAACGCG
CCACGAAAGCCGGTTTTGTTGTTGGCGGTGTGGGTCTGCTGATTGCGGTACTGGCGCTCGTCGCCGTGGT
CGTGATGTTGCCACTAAAACAGACAGACGTTGATCTGTATACCGTGGATAACCACACAGGACGGGTGGAA
CATGTTACCCGGACATCGAAAACCAGCCTGACCGCAACAGAAGCCTATCAAAAGGCGATGGCCGCAAACT
ACGTCAAAGTACGTGAGCGGTATGTCTATCCCTCTTTGCAGGACGACTACGAGACGGTACAGGTCTACAA
CGCTCCCCAGGTAAACGATGACTATCTGGCGCTTTACGCCGGAAAAAACGCCCCGGACAAGGTTTATAAG
AACGGTGCGCACACCGTGAAAGTGGAGATCCTGTCCAACCAGATCACCGATGGAACAGCCCCCGATAAAG
TCGCCACTGTTCGCTACAAGAAGATTATCCGCCGTCTGGCTGATAACAGCACCCGCAACGAGTATTGGGA
TGCCCGGTTCACATTCCATTCAGACCCTGACAAGGACATGAGCGATGCGGAACGCGAGATCAACTACTTC
GGCTTTACCGTCACCAGTTGGCAGACCGACCGCGAAATCCGGGGAGGTGAATGA
 Primer design