SecReT4
Protein ID: 218705492
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2293
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2320124..2321032 [+]
Productputative type IV secretory pathway VirB9 component
Component typeVirB9
UniProt IDB7NBZ2
KEGG IDeum:ECUMN_2293
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.5e-55, Aligned region: 30..276
Protein Sequence: 302 a.a.     [Download]
>gi|218705492|ref|YP_002413011.1| putative type IV secretory pathway VirB9 component [Escherichia coli UMN026]
MMKKLTFTALALMMCGAAWGAAIPQASRYDSRVQQVIYNPQNVTVVNTKPGFMTTLVFDNDEAVISAKPG
FDEAWEATPDANRVNVRPVALTQGAPGEDGNTTQVVIPPNSRDWHTNMLVVTSKRLYNVELNVIDDKSAQ
QPAFQVSYRYPGEERDKASREATARQREWEQKQQQASVQKALNSAQTPRNWSYTKYPGKGSFNIVPDFAY
DDGRFTFVGFSPSKSIPSVTKELNGKEHAVNSSIQKKGDFTVLVIQEVTPRLVLRSGNAVVGLENSGFGK
VHAADGSTVSRQVERVEKPESN
 
Nucleotide Sequence: 909 bp     [Download]
>ref|NC_011751.1|:2320124-2321032 putative type IV secretory pathway VirB9 component [Escherichia coli UMN026]
ATGATGAAAAAGTTAACGTTTACCGCACTGGCACTGATGATGTGCGGCGCGGCATGGGGTGCGGCCATAC
CACAGGCAAGCCGCTATGACTCCCGTGTTCAGCAGGTTATCTATAACCCTCAGAACGTCACCGTCGTTAA
CACCAAACCCGGCTTTATGACAACGCTGGTATTTGATAACGATGAGGCGGTCATAAGCGCCAAACCCGGC
TTTGATGAGGCGTGGGAAGCAACGCCGGATGCAAACCGGGTAAACGTTCGCCCGGTTGCGCTCACGCAGG
GAGCGCCCGGAGAAGATGGCAACACAACGCAGGTCGTGATCCCCCCGAACAGCCGGGACTGGCATACCAA
TATGCTGGTTGTCACCAGTAAGCGCCTGTACAACGTCGAGCTGAACGTCATCGATGATAAATCGGCACAG
CAACCCGCTTTTCAGGTGAGCTATCGCTATCCGGGCGAAGAACGGGACAAAGCGAGCCGGGAGGCGACGG
CCAGACAGCGCGAGTGGGAGCAGAAACAGCAACAGGCCAGCGTCCAGAAAGCGCTGAACTCGGCGCAGAC
GCCCCGCAACTGGAGTTACACCAAATATCCGGGCAAAGGCAGTTTCAACATAGTTCCCGACTTTGCTTAT
GACGATGGCCGCTTTACGTTCGTGGGCTTCTCCCCGTCTAAGTCCATTCCTTCTGTCACCAAAGAGCTGA
ACGGCAAAGAGCATGCGGTTAACAGCAGTATCCAGAAGAAAGGCGACTTCACCGTACTGGTGATTCAGGA
GGTGACGCCACGCCTGGTACTGCGTTCCGGTAATGCCGTTGTAGGTCTGGAAAATAGCGGATTTGGCAAG
GTACACGCCGCCGATGGTTCCACCGTATCCCGGCAGGTGGAAAGAGTGGAAAAACCGGAATCCAATTAA
 Primer design