SecReT4
Protein ID: 218705493
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2294
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2321070..2322338 [+]
Productputative type IV secretory pathway VirB10 component
Component typeVirB10
UniProt IDB7NBZ3
KEGG IDeum:ECUMN_2294
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.8e-51, Aligned region: 225..410
Protein Sequence: 422 a.a.     [Download]
>gi|218705493|ref|YP_002413012.1| putative type IV secretory pathway VirB10 component [Escherichia coli UMN026]
MQMNDENKVPVPDEAQASPAHAEDDIATLEREARVKREAELLNAQDDEEKDPVQPAVNKLKKRKRGKATA
FLAIVAVALIFLAWGGNWVYRNILWQPTEEKKQDTAPQTNKTDYRQRNDLGMSIDTAEEEPEQQDNGQSS
AGGTGQAAAPPELNKASFLIRRDGSATTQNQVKTRQQEMTLTSATTTGQQDSSAATPPGQPQNTTAPSQG
QSPAPVRRIPYNPDLYIPENTSIPCSLDRRFVSDRAGKLRCTVTTDIWSASGNTKLIEKGTTASLLYRAI
AEEGMRHGQGRAFIIATKLRTRQPPYLDIPLVDTSAAGELGEAGVDGWIDSHFWERFGGALMVGMIPDIA
AWASNSAGKKDRNTDYTENSRQAMADMARTTLENSINIPPTLHKNQGEIINLITGEDIDFSNIYTLRLKN
DR
 
Nucleotide Sequence: 1269 bp     [Download]
>ref|NC_011751.1|:2321070-2322338 putative type IV secretory pathway VirB10 component [Escherichia coli UMN026]
ATGCAGATGAACGACGAAAACAAAGTGCCTGTGCCGGATGAAGCGCAGGCATCCCCGGCACACGCTGAGG
ATGATATTGCCACGCTTGAGCGGGAAGCCCGCGTAAAAAGGGAGGCAGAGCTTCTCAACGCGCAGGACGA
CGAAGAGAAAGACCCGGTACAACCCGCCGTTAACAAGCTGAAAAAGCGCAAACGGGGCAAAGCAACCGCC
TTTCTTGCCATTGTCGCGGTCGCGCTTATCTTCCTGGCATGGGGTGGTAACTGGGTTTATCGCAATATCC
TGTGGCAGCCTACGGAAGAAAAGAAACAGGACACAGCCCCGCAGACGAACAAAACCGATTACCGGCAGCG
TAACGATCTCGGTATGTCCATCGATACAGCCGAAGAAGAGCCAGAGCAACAGGATAACGGCCAGAGCAGC
GCGGGGGGAACAGGGCAGGCGGCTGCCCCGCCAGAACTCAACAAAGCCAGCTTCCTTATTCGCCGTGATG
GTTCGGCCACCACACAGAACCAGGTAAAAACCCGGCAGCAGGAAATGACGCTGACATCGGCAACAACCAC
CGGACAACAGGACAGCAGCGCGGCCACACCTCCCGGCCAGCCGCAAAATACCACCGCACCGTCGCAGGGA
CAAAGCCCCGCACCAGTACGGCGCATACCCTATAACCCTGACCTGTACATCCCGGAAAATACCTCGATCC
CCTGCTCACTGGATCGCCGCTTTGTATCTGACCGGGCGGGGAAACTTCGCTGTACGGTCACTACTGACAT
CTGGAGCGCCAGCGGCAACACGAAGCTGATAGAGAAAGGCACTACCGCATCATTACTTTACCGCGCCATA
GCGGAAGAAGGTATGAGGCACGGGCAAGGGCGGGCATTCATCATTGCGACGAAGCTACGCACCCGCCAGC
CACCTTATCTCGATATCCCGTTGGTTGATACCAGCGCGGCTGGCGAGCTGGGCGAGGCTGGCGTTGATGG
GTGGATAGATTCGCACTTCTGGGAGCGATTCGGCGGCGCATTAATGGTTGGCATGATCCCCGATATTGCC
GCATGGGCATCCAACAGCGCAGGTAAAAAAGACCGCAATACGGACTATACGGAAAACAGTCGCCAGGCTA
TGGCAGATATGGCTCGTACCACTCTGGAAAACAGCATCAATATTCCCCCAACGCTCCATAAGAATCAGGG
CGAGATCATCAATCTGATCACAGGCGAGGATATTGATTTTTCCAACATCTATACACTAAGGTTGAAAAAT
GACCGCTAA
 Primer design