SecReT4
Protein ID: 218705494
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2295
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2322328..2323353 [+]
Productputative type IV secretory pathway VirB11 component
Component typeVirB11
UniProt IDB7NBZ4
KEGG IDeum:ECUMN_2295
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.7e-46, Aligned region: 18..279
Protein Sequence: 341 a.a.     [Download]
>gi|218705494|ref|YP_002413013.1| putative type IV secretory pathway VirB11 component [Escherichia coli UMN026]
MTAKNISLDRYKQRFFGDFLELPGLTEIAVNRPGELYTKINGVWEQHAVPLNYEDCYNFARCLAKHHGDN
IEDIKPGLSATLESGERCQVIVPPACERDTVSITIRKPSKVQIPHQSYIDAGFYNRVTGEEKTETHDEEL
IALYNTKNIPLFMEKCVEYGKTLAVAGETSTGKTTYMKMLIGYIPVHLRISTIEDNPEITFFIHKNYVHL
FYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVRGAEAWDFLKITGSGHEGSMTSIHAGSAKEAIDG
FITRCYENPQCAQLPYTFMLRKVLDSLDVIVSIDLDGNVRRMNDIYFRPIHRNQYFEEMKA
 
Nucleotide Sequence: 1026 bp     [Download]
>ref|NC_011751.1|:2322328-2323353 putative type IV secretory pathway VirB11 component [Escherichia coli UMN026]
ATGACCGCTAAGAATATTTCCCTCGACCGCTATAAACAACGTTTCTTTGGCGACTTTCTGGAGCTTCCCG
GCCTGACGGAAATCGCCGTCAACCGTCCAGGTGAACTGTACACAAAAATCAACGGCGTGTGGGAGCAACA
TGCCGTTCCTTTGAACTATGAGGATTGCTACAACTTTGCCCGGTGCCTGGCAAAACACCACGGCGACAAT
ATCGAAGATATTAAGCCGGGGCTGTCAGCCACGCTGGAATCCGGCGAACGGTGCCAGGTGATTGTTCCTC
CGGCCTGTGAGCGCGATACGGTGTCTATCACCATCCGTAAGCCATCAAAGGTACAAATCCCGCATCAGTC
ATATATCGATGCGGGGTTTTATAACCGGGTAACAGGCGAGGAAAAAACGGAGACGCACGACGAGGAATTA
ATTGCATTGTACAATACAAAAAACATTCCTTTGTTTATGGAGAAATGCGTCGAGTACGGTAAAACTCTCG
CGGTCGCCGGGGAAACCAGTACAGGGAAAACTACCTATATGAAAATGTTGATAGGTTATATTCCGGTACA
TCTTCGGATATCAACAATTGAGGACAACCCGGAAATCACGTTCTTTATCCATAAAAACTACGTCCATCTT
TTTTATCCGTCAGAATCATCAGATGAAAAAGGTTCTATCGTTACCCCGGCGAGCCTTTTACGCTGGAATT
ACCGTATGAACCCTGACCGCATTTTATTAACAGAGGTTCGCGGTGCGGAAGCCTGGGACTTCCTTAAAAT
AACAGGTTCCGGCCATGAAGGGAGTATGACCTCCATTCATGCAGGATCAGCGAAAGAAGCTATAGATGGG
TTTATTACCCGTTGCTATGAAAATCCACAGTGCGCCCAGCTCCCCTATACATTTATGTTACGTAAGGTTC
TGGATAGCCTGGACGTGATTGTGAGCATTGATTTAGACGGAAATGTCCGCCGTATGAATGACATTTATTT
CCGTCCAATTCATCGAAACCAGTATTTTGAGGAAATGAAAGCATGA
 Primer design