SecReT4
Protein ID: 218705497
T4SS name [ID]VirB [401]
Gene symbol-
Locus tagECUMN_2299
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T4SS(s) in this replicon]
Location [Strand]2325151..2327010 [+]
Productputative MobB mobilization protein
Component typeVirD4
UniProt IDB7NBZ8
KEGG IDeum:ECUMN_2299
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.2e-05, Aligned region: 194..266
Protein Sequence: 619 a.a.     [Download]
>gi|218705497|ref|YP_002413016.1| putative MobB mobilization protein [Escherichia coli UMN026]
MILNKLAASLSPIVNGMLALLAFVQQQQLVLALLAGLTMPFFASMKSDERQKAPLWKKLIIAFSLLCFLS
GTLAPVVIGPFQWLYKIRPSSDNTVLAWSVRIAFTVTGVIFHIMLRRIFTPELDKIKKRLVKKTTLEREL
RTDVRTVKSLLPETLHYDPLDYIDLNKGIFTGMDRENEPMYLPLKDWQKQHADIIGTTGAGKGVAAGILL
YQSIIAGEGVFVMDPKDDEWAPHLYRKACEDAGKPFALIDLRKQQYQLNLIEDITPDELEELFVAGFSLA
EKGQESDFYRIDDRKAARMAAQFVSDNPSATLRDIYNGDYVQGIAEKIKAFFGKIEELALLNAINSPEGF
SLKHIFDEGGCCYVVGSMRNSKIITAQRMLLVRLYQLAERRDRVTDVPRPIAVYLSELKYHLSRPALEGL
GAARDKGVHIIMDHQSIADLKDCPADLKGDAVVGAVVENAKFKLVYRVMDPDTAGWVARMSGTILVDDEL
RKAKTDNMLTETIDSERTIRQAERFFIDSNMILNLPDFVSFIFTTKTLPSASLISPIKVRKRQLKIFSVS
PDIAAAAAPVKIMLDFGEDDKPAMPDVMTTHPALFFDESEVKPAKSQSDDEEHFSPLDF
 
Nucleotide Sequence: 1860 bp     [Download]
>ref|NC_011751.1|:2325151-2327010 putative MobB mobilization protein [Escherichia coli UMN026]
ATGATTTTAAATAAGCTTGCCGCTTCACTGTCGCCGATAGTGAACGGGATGCTGGCGCTGCTCGCTTTTG
TGCAACAGCAACAACTGGTGCTGGCGTTATTAGCGGGGCTGACGATGCCGTTTTTTGCGTCGATGAAAAG
CGATGAACGGCAGAAAGCCCCGTTATGGAAAAAGCTGATTATCGCTTTTTCCCTGCTGTGTTTTCTCTCC
GGCACACTGGCTCCGGTCGTTATCGGACCCTTTCAGTGGTTGTATAAGATCAGACCCAGCAGTGATAATA
CGGTACTGGCTTGGTCAGTACGGATTGCATTCACTGTAACCGGGGTTATTTTTCATATTATGCTTCGCCG
GATATTCACGCCGGAACTGGACAAAATAAAGAAACGCCTTGTTAAAAAAACCACCCTTGAACGGGAATTG
CGCACCGATGTCCGCACCGTAAAGTCCCTGCTGCCCGAAACACTGCATTATGATCCGCTGGATTATATCG
ACCTGAATAAAGGCATTTTTACTGGCATGGACAGGGAGAACGAACCAATGTATCTCCCGTTAAAAGACTG
GCAGAAACAGCACGCGGATATTATTGGCACCACCGGAGCCGGTAAAGGGGTAGCTGCCGGGATATTGCTA
TATCAAAGTATTATTGCCGGTGAAGGCGTTTTTGTTATGGACCCCAAAGACGATGAATGGGCACCACACC
TTTACCGCAAAGCCTGCGAGGATGCAGGAAAACCCTTTGCCTTAATTGACCTGCGAAAACAGCAATACCA
GCTAAACCTGATTGAAGATATTACGCCAGATGAACTGGAAGAATTGTTCGTTGCCGGTTTCAGCCTGGCA
GAAAAAGGGCAGGAATCGGACTTCTATCGTATTGATGACCGAAAAGCCGCCCGTATGGCCGCGCAATTTG
TCAGTGATAACCCATCGGCAACTCTCCGTGATATTTATAACGGTGATTACGTTCAGGGTATTGCCGAAAA
AATCAAAGCGTTCTTTGGGAAGATTGAGGAACTGGCATTACTCAATGCCATTAACTCACCAGAAGGCTTT
TCGCTTAAGCACATATTTGATGAGGGCGGCTGCTGTTATGTAGTCGGCTCCATGCGAAACAGCAAAATTA
TTACCGCCCAGCGCATGCTGCTGGTTCGCCTTTACCAGTTAGCAGAAAGGCGCGACCGTGTAACAGACGT
ACCCCGCCCCATTGCTGTTTATCTTTCCGAACTGAAATACCATTTATCCAGGCCAGCGCTGGAAGGTTTA
GGCGCGGCGCGGGATAAAGGCGTACACATTATTATGGACCACCAGTCCATCGCCGATTTAAAAGACTGCC
CGGCAGATTTGAAAGGTGACGCCGTTGTCGGTGCGGTCGTTGAAAATGCCAAATTCAAACTGGTTTACCG
GGTTATGGATCCGGATACGGCAGGCTGGGTGGCAAGAATGTCAGGCACGATTCTGGTGGATGACGAACTC
CGCAAGGCTAAGACGGATAATATGCTGACAGAAACCATCGACAGTGAGCGCACAATCCGCCAGGCCGAAC
GTTTCTTTATTGACAGCAATATGATCCTGAACCTGCCCGATTTTGTCAGCTTTATCTTTACGACAAAAAC
GCTACCTTCTGCCTCCTTGATTTCACCGATAAAGGTCAGAAAGCGTCAGCTAAAAATCTTCTCGGTTTCC
CCTGATATTGCCGCAGCGGCAGCCCCGGTGAAGATCATGCTGGATTTTGGCGAGGATGATAAACCAGCCA
TGCCGGATGTGATGACAACCCATCCGGCTCTTTTCTTCGACGAAAGCGAAGTAAAACCGGCAAAGTCCCA
ATCTGATGATGAAGAACACTTCTCCCCACTGGATTTTTAA
 Primer design