SecReT4
Protein ID: 218711117
T4SS name [ID]Tra_I [168]
Gene symboltrbC
Locus tagpECED1a_0093
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]63343..65646 [-]
ProductConjugal transfer protein
Component typeTrbC_I
UniProt IDB7LIP1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 3e-06, Aligned region: 437..525
Protein Sequence: 767 a.a.     [Download]
>gi|218711117|ref|YP_002418737.1| Conjugal transfer protein [Escherichia coli ED1a]
MSQHHVNPDLIHRTAWGNPLWNALHNLNITGLCLAGSIITALIWPLALPVCLLFTLVTSVIFMLQRWRCP
LRMPMTLSLDDPSQDRKVRRSLFSFWPTLFQYEADETSPARGIFYVGYRRINDIGRELWLSMDDLTRHVM
FFATTGGGKTETTFAWLLNPLCWGRGFTFVDGKAQNDTTRTIWYLSRRFGREDDIEVINFMNGGKSRSEI
IQSGEKSRPQSNTWNPFAFSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVRERKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAITPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFTTFAETFGDVFAADAGDIDIRDSIHSDRILIVMIPALDTSAHTTSALGRMFVTQQSMILARDLGYRLE
GTDAQTLEVKKYKGSFPYICILDEVGAYYTDRIAVEATQVRSLEFSLIMMAQDQERIEGQTSATNTATLM
QNAGTKFAGRIVSDDKTARTVKNAAGEEARARMGSLQRHDGVMGESWVDGNQITIQMESKIDVQDLIRLN
AGEFFTVFQGDVVPSASVYIPDSEKSCDSDPVVINRYISVEAPRLERLRRLVPRTVQRRLPTPEHVSSII
GVLTAKPSRKRRKNRTEPYRIIDTFQRRLATAQTSLDLLPQYDTDIESRANELWKKAVHTINNTTREERR
VCYITLNRPEEEHSGPEDIPSVKAILNTLLPLEMLLPVPDLTASPPHKKNVAQTPSGGKQESRKKRF
 
Nucleotide Sequence: 2304 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c65646-63343 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGAGCCAGCACCACGTTAATCCTGACCTCATACACCGCACGGCCTGGGGAAACCCGTTGTGGAATGCAC
TGCATAACCTGAACATCACTGGTCTGTGTCTGGCCGGCAGTATCATTACGGCGCTGATATGGCCACTGGC
CCTTCCTGTCTGCCTGCTGTTCACCCTGGTCACCTCCGTGATATTCATGCTGCAACGCTGGCGATGCCCC
CTGCGTATGCCCATGACACTCAGCCTTGATGACCCCTCCCAGGACAGAAAGGTCAGGCGAAGCCTCTTCA
GCTTCTGGCCCACCCTGTTTCAGTATGAAGCAGATGAAACATCCCCCGCACGGGGGATTTTTTATGTCGG
TTACCGCCGTATCAATGATATCGGTCGTGAGCTCTGGCTGAGCATGGATGACCTCACCCGGCATGTCATG
TTTTTTGCCACCACCGGTGGCGGTAAAACAGAAACCACCTTTGCCTGGCTGCTCAACCCGCTCTGCTGGG
GAAGAGGCTTTACCTTTGTTGACGGAAAGGCACAGAACGATACCACGAGGACAATCTGGTATCTCTCCCG
ACGTTTTGGCCGGGAGGATGATATCGAGGTCATCAACTTCATGAACGGCGGAAAATCCCGCAGTGAAATC
ATTCAGAGCGGCGAAAAATCCCGCCCACAGTCAAACACCTGGAACCCGTTCGCATTCAGCACCGAAGCCT
TCACCGCCGAAACCATGCAGTCCATGCTGCCCCAGAACGTTCAGGGGGGAGAATGGCAGTCACGGGCGAT
AGCCATGAACAAAGCCCTGGTCTTTGGCACAAAATTCTGGTGCGTCCGGGAAAGAAAAACCATGTCCCTG
CAGATGTTACGGGAACATATGACGCTGGAAGGGATGGCAAAACTCTATTGCCGTGGCCTTGATGACCAGT
GGCCGGAAGAAGCTATCACACCACTGCGAAACTACCTGCAGGATGTCCCGGGATTCGATATGTCACTGGT
GAGAACGCCGTCAGCCTGGACTGAGGAGCCCCGTAAACAGCATGCTTATCTCTCCGGTCAGTTCTCGGAA
ACATTCACAACCTTTGCCGAAACCTTCGGGGACGTCTTTGCGGCAGATGCCGGCGACATCGATATTCGCG
ACAGTATTCACAGCGACCGCATTCTGATTGTGATGATCCCTGCACTGGACACATCGGCCCATACCACGTC
GGCACTCGGTCGTATGTTCGTCACCCAGCAGAGCATGATCCTCGCCCGTGACCTGGGCTACCGCCTGGAA
GGCACAGATGCACAGACCCTGGAAGTCAAAAAATACAAAGGCAGCTTCCCCTATATCTGTATCCTTGACG
AAGTCGGTGCCTACTACACAGACCGCATTGCTGTGGAGGCCACCCAGGTACGTTCACTGGAGTTTTCCCT
GATAATGATGGCGCAGGATCAGGAGCGAATCGAAGGGCAGACTTCTGCCACCAACACCGCCACGCTGATG
CAGAACGCCGGCACCAAATTCGCCGGACGCATTGTCAGTGACGACAAAACAGCAAGGACGGTGAAAAATG
CCGCCGGTGAAGAGGCCCGCGCCAGAATGGGCAGCCTGCAGCGCCACGATGGTGTGATGGGTGAGTCCTG
GGTGGACGGTAACCAGATCACAATCCAGATGGAAAGCAAAATCGACGTGCAGGATTTGATCAGACTGAAT
GCCGGTGAGTTCTTTACCGTTTTCCAGGGGGATGTGGTGCCGTCAGCCTCTGTGTATATTCCGGACAGCG
AGAAAAGTTGCGACAGTGATCCGGTGGTCATCAACCGCTATATTTCCGTTGAAGCCCCCCGGCTGGAGCG
TCTCCGCCGTCTCGTCCCCAGGACAGTGCAGCGCAGGCTCCCCACACCGGAGCATGTCAGCAGCATCATC
GGTGTACTGACAGCAAAACCATCCCGTAAACGTCGTAAAAACCGTACAGAGCCTTACCGTATCATTGATA
CATTCCAGCGCCGGTTGGCAACAGCGCAGACATCACTGGATCTGCTTCCGCAATATGATACAGATATCGA
ATCCCGGGCAAACGAACTGTGGAAAAAGGCTGTGCACACTATCAATAACACAACCAGGGAAGAACGCCGG
GTATGTTATATCACACTGAATCGTCCGGAAGAGGAACACTCTGGTCCTGAAGATATACCTTCAGTGAAGG
CGATTCTGAATACTCTGCTCCCCCTGGAGATGCTGTTACCTGTACCGGATCTAACTGCATCCCCGCCCCA
TAAAAAAAATGTCGCTCAGACACCATCAGGTGGAAAACAAGAGAGTCGTAAAAAAAGATTCTGA
 Primer design