SecReT4
Protein ID: 218711118
T4SS name [ID]Tra_I [168]
Gene symboltrbB
Locus tagpECED1a_0094
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]65627..66751 [-]
ProductConjugal transfer protein
Component typeTrbB_I
UniProt IDB7LIP2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Thioredoxin_2 [PF13098], Evalue: 4.5e-06, Aligned region: 222..337
Protein Sequence: 374 a.a.     [Download]
>gi|218711118|ref|YP_002418738.1| Conjugal transfer protein [Escherichia coli ED1a]
MTIHYTATLNNKHLSLTALYPDGNREVIAILPVTELGALINRNNRLMHLSFSSPFREITETVLVDTVDAE
RPGHHIGRMLSAIDACLDAEYAGKGKHPSRKYGFWRTLMCGFIAGIALPATVAGYHWMKAEPPSTLAYPT
SQEWRAEPVTDTETPRPHTEHHVNSIPARPAPTQQEPSSTPAPTAVTEEQHVQAAEARRNLATVLKRNAD
RGMFTINLSTGHERTLYAFLDPACINCRLLEPALKQLAREFSVVIYPVSVIGGESSTKRTAPLLCEPDSQ
KRATGWHQLYSADSGMAPTGDAPAAQDGQCLTAARAAIDVNNQAFRQFGFGGTPWVLSDTGWHLPSGILK
DATSVRLFLKATDSEEYHNEPAPR
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c66751-65627 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGACCATCCACTACACTGCAACACTGAATAATAAACACCTGTCCCTGACCGCCCTGTACCCTGACGGTA
ATCGGGAGGTGATTGCCATCCTGCCGGTCACAGAACTGGGCGCACTGATTAACCGTAATAACAGGCTGAT
GCACCTGTCCTTCAGTTCCCCTTTTCGCGAAATAACCGAAACGGTGCTTGTTGATACCGTTGATGCAGAA
CGTCCCGGACATCACATCGGCAGAATGCTCTCAGCGATTGATGCCTGCCTGGATGCCGAATATGCCGGAA
AAGGAAAACATCCCTCCCGGAAATATGGCTTCTGGCGGACACTGATGTGTGGCTTTATCGCCGGAATTGC
TCTGCCGGCGACAGTTGCAGGTTACCACTGGATGAAGGCAGAGCCCCCTTCCACGCTGGCTTACCCTACA
TCTCAGGAATGGAGAGCTGAACCAGTAACCGACACAGAGACACCACGCCCACATACGGAACATCATGTTA
ACAGCATCCCGGCCCGCCCGGCTCCCACACAGCAGGAACCTTCTTCTACCCCCGCCCCGACGGCAGTGAC
GGAAGAACAACACGTTCAGGCCGCTGAGGCCCGCCGTAATCTGGCCACAGTACTTAAACGCAACGCAGAC
CGGGGGATGTTCACCATTAACCTGTCCACTGGTCATGAACGCACGCTGTACGCCTTCCTTGACCCCGCAT
GCATCAACTGCCGTCTGCTGGAACCCGCGCTTAAGCAACTGGCCCGGGAATTCAGCGTGGTGATTTATCC
GGTCTCCGTGATTGGCGGGGAGTCCAGTACAAAGCGGACTGCTCCGCTGCTGTGTGAACCGGACTCACAA
AAACGGGCGACCGGATGGCATCAGCTGTATTCCGCTGACAGTGGTATGGCCCCCACCGGCGATGCACCGG
CCGCACAGGATGGACAGTGTCTGACCGCCGCACGTGCTGCCATCGATGTCAATAACCAGGCTTTCCGCCA
GTTCGGTTTTGGCGGAACCCCCTGGGTGTTATCAGATACCGGCTGGCACCTGCCGTCCGGCATCCTGAAA
GACGCCACTTCCGTTCGCCTCTTCCTGAAAGCAACAGATAGCGAGGAGTATCACAATGAGCCAGCACCAC
GTTAA
 Primer design