SecReT4
Protein ID: 218711120
T4SS name [ID]Tra_I [168]
Gene symboltrbA
Locus tagpECED1a_0096
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]66748..68109 [-]
ProductConjugal transfer protein
Component typeTrbA_I
UniProt IDB7LIP4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 453 a.a.     [Download]
>gi|218711120|ref|YP_002418740.1| Conjugal transfer protein [Escherichia coli ED1a]
MSYQHSPTTEDPMNIWYIVGTICLLFAFLIWLFLPDIVFATCLILHTMWGMTDWGPFHHFAAPRYNLLAN
TANNAATITFSQWLDVMSQTVGILWLILLPMTLGFLWMWFQHPAQPRFTRRPLNIHTLPHLFSSLSPAIA
PVLADGDSNRLFHGQKRPERRVALTPEVFVAQNNLIRNMQLDVAATRQCFMEQLGQPLTTWKDMAPHEKA
LFAVFGLQFFLGDRKAAVSLMNNLNLSCRLKSKRDQGRFSTPVYSLARNAFIRVIKTEDAQQWLRQHRYV
RSGLVWLYAHDLRLTPPNWLWLKGVDRTLFYALHRANTTKGFIEGAGVVAVARAENEASRLGLPCPEPCV
EEAIEGLRRDMLGLGLIWDEPQPDRDRRRQIRTRWSLTDDVIPRRHDNDEDTDTGETTETTETTETTETT
ETTETTETTETTETTETTETTEKQHPADKEKEQ
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c68109-66748 Escherichia coli ED1a plasmid pECOED, complete sequence
GTGTCTTACCAACACTCACCCACAACTGAAGACCCGATGAATATATGGTATATCGTTGGCACCATATGCC
TGCTCTTTGCGTTTCTCATCTGGCTCTTTTTACCCGACATCGTCTTTGCCACCTGCCTGATCCTGCACAC
AATGTGGGGGATGACTGACTGGGGGCCTTTTCACCATTTTGCCGCCCCCCGTTATAACCTGCTGGCCAAC
ACCGCCAACAACGCTGCAACGATCACTTTCAGCCAGTGGCTGGATGTCATGTCACAGACCGTGGGGATCC
TCTGGCTGATTCTGCTTCCCATGACGCTCGGCTTTCTGTGGATGTGGTTTCAGCATCCGGCCCAGCCCCG
CTTCACCCGCAGACCACTGAATATCCACACGCTGCCACACCTGTTTTCATCACTGTCACCGGCGATCGCC
CCCGTTCTGGCTGACGGAGACAGCAACAGACTCTTCCACGGACAAAAACGTCCCGAGCGCCGTGTCGCTC
TAACCCCGGAAGTCTTTGTGGCGCAGAACAACCTTATCCGTAACATGCAGCTCGATGTTGCGGCCACACG
CCAGTGCTTTATGGAGCAACTGGGCCAGCCTCTGACCACCTGGAAAGACATGGCTCCACATGAAAAAGCA
CTCTTTGCCGTCTTTGGCCTGCAGTTCTTCCTTGGGGACCGGAAAGCGGCTGTTTCCCTGATGAATAACC
TCAACCTCTCCTGCAGACTCAAAAGCAAGCGGGACCAGGGGCGTTTCAGCACGCCAGTGTATTCACTGGC
CAGAAACGCCTTTATCCGGGTCATAAAAACAGAAGACGCACAACAGTGGCTCAGGCAGCACCGTTACGTT
CGCAGCGGTCTGGTCTGGCTTTACGCACATGATTTGCGCCTGACGCCCCCCAACTGGCTGTGGCTCAAGG
GCGTTGACCGGACGCTCTTCTATGCCCTTCACCGGGCAAACACCACAAAAGGCTTCATCGAAGGGGCCGG
CGTGGTGGCCGTTGCCCGGGCAGAAAATGAAGCCAGCCGTCTCGGCCTCCCCTGCCCGGAACCCTGTGTG
GAAGAGGCCATTGAAGGGCTTCGACGGGACATGCTGGGGCTGGGCCTGATATGGGACGAACCTCAGCCAG
ACCGCGATCGCAGACGCCAAATCAGGACCCGCTGGTCACTCACGGATGACGTGATACCCCGCCGCCATGA
TAACGACGAAGACACTGACACTGGTGAAACCACCGAAACCACCGAAACCACCGAAACCACCGAAACCACC
GAAACCACCGAAACCACCGAAACCACCGAAACCACCGAAACCACCGAAACCACCGAAACCACCGAAAAAC
AGCATCCCGCCGACAAGGAAAAAGAACAATGA
 Primer design