SecReT4
Protein ID: 218711128
T4SS name [ID]Tra_I [168]
Gene symboltraY
Locus tagpECED1a_0104
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]74497..76656 [-]
Productconserved hypothetical protein, putative membrane protein
Component typeTraY_I
UniProt IDB7LIQ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 719 a.a.     [Download]
>gi|218711128|ref|YP_002418748.1| conserved hypothetical protein, putative membrane protein [Escherichia coli ED1a]
MKIIPRALSAGLALAAVPAQAFVTYQDIVSAATNPDDLSRQALVTIFGDVVTNPLTASSNTIIGNLFMVF
NAIIATMGIVWFLFIGIRHAVRTGHQGSVFNNGRDVVGILSVVSGFLMIVPTASGWSLAQLVMLWGASIM
GIGSANIMVQTAAENIAEGYSMTVQPVHVSTRTAARGILEMELCKHAMNTGLDDFNRTARSSTPLMSESS
RTENGRYTVTVSNGSATCGSVSLSVKGNGSNKQSALAHFFNPFIETEYQGVLTAQRSAMDTMLRDLDSAA
QEFVSAYRTRRDTGNGNLPDIESRIQKAANRYEETVQKALPADNAETERREQLKSYLTTYGWVALGAWYQ
TFATANQRLEDLANRAPTVSGVSSLGEAGDTEFLKEVKGAYQAQLQNSTYTPALGTLKSANEYNSAGSND
PQSAILSSIPGVELTNNVATIFTKTGTTTDQLNPLIKMKNIGDYTMGITESIWAGYTTVRVLSTAGSNSI
FGRLVNTVTGLPEAAKVFMEAAAPPLYFLLFLLFCAGFSLSIYLPFIPFIFWMTGIGNWIVSVLIGCAAG
PLWAATHLGTSQDRGSRAAYGYIYLIDSMIRPLLMVFGFFFASVAIIAAGTILNSLFGAALANVQTDSLT
GLFSMAGFLLIYARVCTTLVAAVFALQAYLPDHVINFLGGRDGVNMLGNMVSSVKDIIAGGNTNMRRTPG
VREEKLKNINRDDKDGIKQ
 
Nucleotide Sequence: 2160 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c76656-74497 Escherichia coli ED1a plasmid pECOED, complete sequence
GTGAAAATCATACCCAGAGCACTGAGTGCAGGTCTGGCGCTGGCTGCCGTACCTGCACAGGCTTTCGTCA
CCTATCAGGACATTGTGAGTGCCGCCACCAATCCGGATGACCTGTCGCGCCAGGCACTGGTCACCATTTT
TGGTGATGTGGTCACAAATCCCCTGACAGCCAGCAGCAACACCATCATTGGTAACCTGTTCATGGTGTTT
AACGCAATTATCGCCACGATGGGGATAGTCTGGTTTCTGTTTATTGGTATCCGTCATGCTGTCCGCACGG
GACACCAGGGCAGTGTCTTTAACAACGGACGGGACGTCGTCGGCATACTCAGTGTTGTGAGTGGATTTTT
GATGATTGTGCCCACCGCTTCCGGCTGGAGTCTGGCGCAACTGGTCATGCTGTGGGGCGCATCCATCATG
GGCATCGGTTCCGCCAATATCATGGTTCAGACAGCGGCAGAAAACATTGCTGAAGGCTATTCAATGACCG
TACAGCCAGTACATGTCTCCACCCGCACGGCAGCACGGGGAATTCTGGAGATGGAACTGTGCAAACACGC
CATGAATACGGGCCTCGATGACTTTAACCGTACCGCACGTTCATCAACGCCGCTCATGAGCGAATCCTCA
CGGACAGAGAATGGCAGATATACCGTCACCGTCTCAAATGGCAGCGCCACCTGCGGGAGTGTGAGTCTCT
CCGTGAAAGGAAACGGCAGTAACAAGCAGTCCGCGCTGGCCCATTTTTTCAATCCCTTCATTGAAACGGA
ATATCAGGGGGTTCTGACGGCACAGCGCTCCGCCATGGATACCATGCTCCGTGACCTGGACAGCGCGGCT
CAGGAATTTGTGTCGGCATACCGGACCCGGCGCGACACGGGTAACGGCAACCTGCCGGATATTGAAAGCC
GTATTCAGAAGGCAGCCAACCGGTATGAAGAAACGGTGCAGAAGGCGTTGCCGGCAGATAACGCAGAAAC
TGAGCGCAGGGAGCAGCTGAAATCCTACCTGACCACCTACGGCTGGGTTGCCCTGGGTGCCTGGTACCAG
ACCTTTGCCACCGCCAACCAGCGACTGGAAGACCTGGCCAACCGTGCTCCTACTGTGAGTGGCGTCTCGT
CACTGGGCGAAGCCGGGGATACGGAGTTCCTGAAGGAGGTCAAGGGGGCTTACCAGGCACAGCTACAGAA
CTCAACGTATACTCCTGCACTGGGAACATTAAAATCAGCAAATGAATATAACAGCGCAGGCAGTAACGAT
CCGCAAAGTGCTATTTTAAGTTCAATTCCTGGAGTAGAACTTACAAATAATGTAGCAACAATCTTTACAA
AAACCGGCACAACCACTGACCAACTAAACCCACTGATAAAAATGAAAAATATCGGTGATTACACTATGGG
CATTACTGAAAGCATCTGGGCGGGTTATACCACCGTCAGGGTGCTTTCGACTGCCGGCAGCAACTCCATT
TTTGGTCGGCTGGTTAATACCGTTACGGGCTTACCTGAGGCTGCAAAGGTTTTTATGGAAGCAGCCGCTC
CACCGCTCTACTTCCTGCTGTTTTTGCTGTTCTGTGCCGGCTTTTCGTTATCCATTTACCTGCCGTTTAT
TCCGTTTATCTTCTGGATGACCGGCATTGGTAACTGGATAGTCAGCGTGCTGATTGGATGTGCTGCTGGC
CCCCTCTGGGCGGCCACCCACCTGGGAACAAGCCAGGACCGGGGAAGCCGGGCCGCTTACGGTTACATCT
ACCTGATAGACAGCATGATCAGACCGCTGCTGATGGTATTCGGGTTCTTCTTTGCGTCAGTCGCTATCAT
TGCTGCCGGAACCATTCTAAATTCGTTGTTTGGAGCTGCACTGGCCAATGTACAGACAGACTCCCTGACG
GGGCTATTCAGCATGGCAGGATTTTTGCTGATTTATGCCCGAGTCTGTACCACGCTGGTTGCGGCCGTTT
TTGCGCTTCAGGCTTATCTGCCTGACCATGTGATTAATTTTCTGGGCGGACGTGACGGTGTTAATATGCT
GGGGAATATGGTTTCTTCAGTCAAAGATATTATTGCCGGAGGTAATACCAATATGCGCAGAACACCTGGC
GTTCGTGAAGAAAAACTGAAAAATATTAATAGAGATGATAAAGACGGAATAAAACAATAA
 Primer design