SecReT4
Protein ID: 218711129
T4SS name [ID]Tra_I [168]
Gene symboltraX
Locus tagpECED1a_0105
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]76731..77300 [-]
Producthypothetical protein
Component typeTraX_I
UniProt IDB7LIQ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|218711129|ref|YP_002418749.1| hypothetical protein pECED1a_0105 [Escherichia coli ED1a]
MRDDNSTDKKKPAPRLRRIGDIGINLFAPLAETRWMLRSCRHMLGQHKTRLKRLMPDRQPESPVCMTWEE
AVRASGLTVNELDRRLRRRRMFWRTGFWLMMIPVLLLCGMALAATALPVITLIRILVCLLLMSAIAALCA
SKALIASYRLWQLNERRVSEDEQGTFPDYLQARHGWKQATWLAITHRQY
 
Nucleotide Sequence: 570 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c77300-76731 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGAGAGACGACAACAGCACCGACAAAAAAAAACCGGCCCCCCGTCTCCGCCGCATCGGTGACATCGGGA
TAAACCTGTTCGCACCACTGGCAGAAACCCGGTGGATGCTGCGCAGCTGCCGCCATATGCTGGGCCAGCA
TAAAACGCGCCTGAAGCGCCTCATGCCCGACCGGCAACCGGAGAGTCCGGTCTGTATGACCTGGGAAGAA
GCCGTCAGGGCCAGTGGCCTTACGGTCAACGAACTGGACCGGCGTCTGCGACGTCGCAGGATGTTCTGGC
GGACAGGATTCTGGCTGATGATGATACCGGTACTTCTGCTGTGTGGTATGGCCCTTGCGGCCACCGCACT
GCCGGTCATCACCCTGATACGTATCCTGGTCTGCCTGTTACTGATGAGTGCCATTGCAGCACTGTGTGCC
TCAAAAGCCCTGATTGCGTCATACCGCCTCTGGCAGCTGAATGAACGTCGGGTCAGCGAGGACGAACAGG
GCACATTCCCCGATTACCTGCAGGCCCGGCACGGCTGGAAACAGGCCACATGGCTGGCCATTACCCACCG
GCAGTACTGA
 Primer design