SecReT4
Protein ID: 218711131
T4SS name [ID]Tra_I [168]
Gene symboltraW
Locus tagpECED1a_0107
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]77297..78607 [-]
Productputative Lipoprotein
Component typeTraW_I
UniProt IDB7LIQ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 436 a.a.     [Download]
>gi|218711131|ref|YP_002418751.1| putative Lipoprotein [Escherichia coli ED1a]
MDHPSLPVLPAGSAAGITQSPRTRHPVSPENGEKRMQRQPATTLLALLIGCTVIPSTHAYPVTVVASQPV
TTQIMPELATIQGIMEEMVRMQTATGTAITQNSEKLATVIAQDGQATRQQMIFSNETRRLEEARKSFSVP
DSICSESASGVAAESRRAAASAAARLSQGGGVSSKPIRERLSRAADSPTREAYDSAGIHAGYCTEAEYAR
FGGTDVCPAVGELPGGDSQVRSLYQGAGTADTPAALTWDQKQIDAATAYMKNTARPSAGRAPGKGEVGTQ
TGRTYVGLQNEYNGIIDAASHPQLSLIADSTPNEATRGALTEALQSPSAAAYFDRTASSEARTRGHMSQR
EFEAFEAGRRYANTDWQQDLQGMEGDNLLRELLRTTALLNWQMNDLKEQIRQGNVIAGQQLALAARQYYG
QRLGELSQAMSQGSVR
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c78607-77297 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGGATCACCCGTCGCTTCCAGTGCTTCCCGCTGGCTCCGCTGCCGGAATCACACAGTCACCGCGTACCA
GACATCCTGTATCCCCTGAAAACGGAGAAAAAAGAATGCAAAGACAACCAGCAACCACACTGCTTGCACT
CCTGATAGGCTGTACGGTTATCCCGTCCACCCACGCCTATCCTGTGACCGTAGTGGCCAGCCAGCCTGTC
ACCACACAAATCATGCCGGAGCTGGCCACCATACAGGGCATCATGGAGGAAATGGTCCGTATGCAGACGG
CCACCGGCACAGCCATCACCCAGAACTCAGAAAAACTGGCCACCGTCATTGCCCAGGACGGGCAGGCCAC
CCGTCAGCAGATGATATTCAGTAATGAAACCCGCCGGCTTGAGGAAGCCCGGAAGAGCTTCAGCGTGCCG
GACTCCATCTGCAGTGAATCCGCCTCCGGAGTTGCAGCTGAAAGTCGCCGTGCAGCAGCGTCTGCGGCTG
CACGTCTGAGTCAGGGAGGAGGCGTCAGCAGTAAACCCATCCGTGAACGTCTCTCCCGGGCAGCAGACTC
ACCAACCCGCGAGGCATATGACAGTGCAGGCATTCATGCCGGTTACTGCACGGAAGCTGAATATGCCCGC
TTTGGCGGAACCGATGTCTGCCCTGCCGTGGGCGAGCTGCCGGGCGGAGACAGCCAGGTGCGATCGCTCT
ATCAGGGTGCAGGCACAGCAGATACCCCTGCCGCCCTCACCTGGGATCAGAAACAGATTGATGCTGCCAC
GGCTTACATGAAAAACACCGCCAGACCGTCAGCGGGTCGTGCCCCGGGGAAAGGAGAAGTGGGCACACAG
ACCGGGCGCACGTATGTGGGCCTGCAGAATGAATACAACGGCATCATCGATGCTGCTTCTCATCCGCAAC
TGTCACTGATAGCTGACAGTACCCCTAATGAGGCCACCCGTGGAGCGCTGACTGAAGCCCTGCAGTCACC
ATCCGCTGCGGCATATTTTGACCGGACCGCATCATCAGAGGCCCGCACCCGTGGTCACATGAGCCAGCGG
GAGTTTGAGGCCTTTGAAGCCGGCAGACGCTATGCAAACACCGACTGGCAGCAGGATCTGCAGGGCATGG
AAGGCGATAACCTTCTCCGTGAACTGCTGCGCACTACCGCCCTGCTGAACTGGCAGATGAACGACCTGAA
AGAGCAGATACGCCAGGGTAATGTTATCGCCGGGCAGCAGCTGGCACTGGCGGCACGACAGTATTACGGA
CAGCGTCTCGGTGAACTGTCACAGGCCATGAGCCAGGGGAGCGTAAGATGA
 Primer design