SecReT4
Protein ID: 218711132
T4SS name [ID]Tra_I [168]
Gene symboltraV
Locus tagpECED1a_0108
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]78463..79080 [-]
Producthypothetical protein
Component typeTraV_I
UniProt IDB7LIQ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 205 a.a.     [Download]
>gi|218711132|ref|YP_002418752.1| hypothetical protein pECED1a_0108 [Escherichia coli ED1a]
MYSIHITPRCRRPARGQVFLKTLRVDGDSFSFTLPSACFTLRPSPNPRVIFASDRRADGEMSGVRLALPG
ETGTLITTATWQVNVPERPPFDIQHVIHWLLPSPLTALMSDNTWLWPDSPGTPALTAGDWPVMETDTPTL
KRVKRRTFTLIDNRNRQGWITRRFQCFPLAPLPESHSHRVPDILYPLKTEKKECKDNQQPHCLHS
 
Nucleotide Sequence: 618 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c79080-78463 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGTACAGCATACACATCACTCCCCGCTGCCGGCGTCCTGCACGGGGACAGGTCTTCCTGAAAACGCTGC
GCGTGGACGGTGACAGTTTCAGCTTCACCCTGCCGTCCGCCTGCTTCACGCTGCGTCCCTCCCCCAATCC
CCGGGTCATTTTCGCCAGTGACAGACGGGCTGACGGGGAAATGAGTGGCGTTCGCCTGGCTCTGCCCGGA
GAGACAGGCACGCTGATAACAACGGCCACCTGGCAGGTCAACGTGCCGGAGCGGCCTCCTTTTGATATAC
AGCATGTCATTCACTGGCTCCTGCCCTCGCCTCTCACGGCGCTGATGTCCGACAACACCTGGCTGTGGCC
GGATAGCCCCGGCACACCGGCACTGACGGCGGGAGACTGGCCGGTAATGGAAACAGATACCCCGACGCTG
AAACGCGTGAAGCGTCGTACCTTCACGCTCATCGATAACCGCAACCGTCAGGGATGGATCACCCGTCGCT
TCCAGTGCTTCCCGCTGGCTCCGCTGCCGGAATCACACAGTCACCGCGTACCAGACATCCTGTATCCCCT
GAAAACGGAGAAAAAAGAATGCAAAGACAACCAGCAACCACACTGCTTGCACTCCTGA
 Primer design