SecReT4
Protein ID: 218711133
T4SS name [ID]Tra_I [168]
Gene symboltraU
Locus tagpECED1a_0109
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]79080..82136 [-]
Productputative Nucleotide-binding protein
Component typeTraU_I
UniProt IDB7LIQ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.4e-43, Aligned region: 506..902
Protein Sequence: 1018 a.a.     [Download]
>gi|218711133|ref|YP_002418753.1| putative Nucleotide-binding protein [Escherichia coli ED1a]
MPHAMNINRIIFAIEDCISTLSRYSVSAFFPDYCDLHTVIGLDQQDRERRPWLKAPYIATTKQGYYLSVF
EISGALKEMDENPDLTAPGTLESLITALAERMNTAWKNSGHKISFVFERDPERGRDEIEAMLLPQRKSIA
RTGILLQDVLDEKVTTLTPWLVRERCWLTVWSSEELLSRTDRKDHQTRIRKLAEHAPPARFAQDPWRWTL
SALKIRHDALLDTLEQALTHDSDGLLVRLMDIHEVGREIRRQLERNSTPAVWQPHLPEDARPAGWRQGED
TSVFHAPSLNLQLFTTQPETHGSLIKAGDLWHGMVAITLPPQNLRTFNQLVRDVPRAIPWRIRMDLMPGG
MKALGVKKTLLTYSSFISPLRPMYDSVMMLNDINKHDPVCIMTIVATTWGNSREVCTRNQALLKSALEGW
GVCGTTTTFGDPRRAWVNTVLAASHGSGPVPLYPPLSHALSLFPLNRAGSVWRGQGNLMMHTEDGSAWEV
ALASSQQNKHTELTPGAPGLGKSVLINALSEIQIASAQKNLPFIAYIDKGFSAQGLVQLIRDSLPEQRKD
EAVGIILSNDPEHTRNLFDVMYGARKPATPEKNFMVSVLCALCVDTGTGQPCNPGDTRQIISNLVDLAFR
EYGENNPRLYRAGTEPLVDLALEESGIAEQHDAGWWNAATWFEIRDMLHMAGNIPAAQRAHYQAMPLLAE
MSALLGQPSIRDVFGTVQRDNSAELLLDYIRRALDQGHSDYPMMSGCTRFMLSPDTRVVAVDLNNVAGDK
TPAGRLRTGIMYLLAGQIAGGDFVLPQYQEEIRKNLDPRYHEVIFRRIEQLDQEVKTKVYDELHNAKGIN
FIWEALDTQELEQRKFGIRTVLSTQLLQDYPPAVLKSANTLWLLRYRPDEIPFLRDNFGVPEVTLRRFLK
MPEGAAPDGSGVPVLAVFRVKNGTLARILKFTLGPLELWALNSSPKDSALRRALTQELGSLRARQILAEH
FPRGSATSLIEHRARTHDSENVIHDLAAELIRKQGYHL
 
Nucleotide Sequence: 3057 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c82136-79080 Escherichia coli ED1a plasmid pECOED, complete sequence
GTGCCCCATGCCATGAATATCAACCGCATTATTTTTGCCATTGAAGACTGTATCAGTACCCTGTCACGGT
ATTCCGTTTCCGCATTCTTCCCCGATTACTGTGATCTGCACACCGTCATCGGTCTGGACCAGCAGGACCG
CGAACGCCGCCCCTGGCTGAAAGCCCCCTACATTGCCACCACAAAACAGGGGTATTACCTTTCCGTCTTT
GAAATCAGCGGTGCCCTGAAAGAAATGGATGAAAACCCGGACCTGACAGCCCCCGGCACACTGGAATCAC
TGATTACAGCGCTGGCAGAGCGAATGAACACTGCCTGGAAAAATTCCGGTCACAAAATCAGTTTTGTTTT
CGAACGCGATCCGGAGCGTGGAAGGGATGAAATCGAAGCCATGCTCTTACCCCAGCGAAAATCCATCGCA
CGCACGGGGATCCTGCTTCAGGACGTTCTGGATGAAAAAGTCACCACGCTCACCCCCTGGCTTGTCCGGG
AACGCTGCTGGCTGACCGTCTGGAGCTCTGAAGAACTGCTGAGCCGGACCGATCGCAAGGACCACCAGAC
CCGTATCAGGAAACTCGCTGAACACGCTCCGCCAGCCCGATTTGCGCAGGATCCATGGCGCTGGACACTT
TCCGCACTCAAAATACGGCATGACGCCTTACTGGACACGCTGGAGCAGGCCCTGACACATGATTCTGATG
GTCTGCTGGTTCGCCTGATGGATATTCATGAAGTGGGACGGGAAATCCGCCGTCAACTGGAGCGCAACAG
CACACCTGCAGTATGGCAGCCTCATCTGCCTGAAGATGCCCGTCCTGCCGGCTGGCGACAGGGTGAGGAT
ACCTCTGTATTCCACGCACCGTCGCTGAATCTGCAGTTATTCACCACACAGCCTGAAACACACGGCAGCC
TGATAAAGGCCGGTGACCTCTGGCACGGTATGGTCGCCATTACCCTGCCACCCCAGAATCTGCGGACATT
CAACCAGCTGGTCAGGGATGTGCCCCGCGCAATCCCCTGGCGTATCCGGATGGATCTGATGCCCGGCGGC
ATGAAGGCGCTTGGGGTCAAGAAAACCCTGCTAACCTACAGCAGCTTTATTTCCCCTCTCCGGCCCATGT
ATGACTCGGTGATGATGCTGAATGACATCAACAAACATGATCCGGTCTGTATCATGACCATTGTTGCCAC
CACATGGGGAAACAGCCGGGAAGTCTGTACCCGCAACCAGGCTCTCCTGAAATCTGCGCTGGAAGGCTGG
GGAGTATGCGGCACCACCACCACCTTCGGTGATCCGAGACGTGCCTGGGTGAACACGGTTCTGGCGGCCT
CCCACGGTTCCGGTCCAGTCCCCCTTTACCCGCCCCTTTCACACGCCCTTTCCCTGTTTCCCCTGAACAG
GGCCGGCTCTGTCTGGCGGGGACAGGGAAATCTGATGATGCACACCGAGGACGGCTCTGCATGGGAGGTC
GCGCTGGCATCGTCACAACAGAACAAGCACACGGAACTGACGCCCGGCGCACCCGGTCTGGGCAAATCGG
TACTCATCAACGCACTGTCGGAGATCCAGATAGCCTCAGCCCAGAAGAACCTGCCTTTCATTGCCTATAT
CGACAAGGGATTCAGTGCACAGGGACTGGTACAGCTTATCCGTGACAGCCTGCCGGAGCAGAGAAAGGAC
GAAGCCGTGGGGATCATTCTGAGCAATGATCCGGAACACACCCGTAACCTGTTTGATGTGATGTACGGTG
CCAGAAAACCCGCCACCCCGGAAAAGAACTTCATGGTATCTGTACTCTGCGCACTGTGCGTGGATACCGG
CACCGGTCAGCCCTGTAATCCCGGTGACACCCGGCAAATCATAAGCAACCTGGTGGATCTGGCCTTCAGG
GAGTATGGCGAAAACAACCCCAGACTGTACCGTGCAGGAACAGAGCCCCTTGTGGATCTCGCCCTGGAAG
AGAGTGGCATCGCAGAACAACATGACGCAGGATGGTGGAATGCTGCCACCTGGTTTGAAATCAGGGACAT
GCTGCATATGGCTGGCAATATCCCCGCAGCCCAGCGGGCACACTACCAGGCCATGCCCCTGCTGGCTGAA
ATGTCCGCCCTGCTGGGACAGCCATCCATCCGGGATGTGTTCGGCACAGTTCAGCGCGATAACTCAGCAG
AATTGTTACTGGACTACATCCGCCGTGCCCTCGATCAGGGACACAGTGACTACCCGATGATGTCCGGCTG
TACCCGGTTTATGCTCAGCCCCGACACCCGCGTTGTGGCCGTTGATCTGAACAATGTGGCCGGTGACAAG
ACACCTGCCGGGCGTCTGCGCACCGGCATCATGTACCTGCTGGCAGGACAAATCGCCGGCGGGGATTTTG
TCCTGCCGCAGTATCAGGAGGAAATACGGAAAAATCTCGACCCACGCTACCATGAGGTGATTTTCCGCCG
CATTGAACAGCTTGATCAGGAGGTCAAGACCAAAGTCTATGACGAACTGCACAATGCAAAAGGGATCAAC
TTCATCTGGGAAGCCCTGGACACCCAGGAGCTGGAGCAGCGTAAGTTCGGGATACGCACAGTACTGAGCA
CCCAGCTACTGCAGGACTATCCACCGGCAGTTCTCAAATCCGCCAACACCCTCTGGTTGCTGCGTTACCG
CCCTGACGAAATTCCGTTTCTGCGGGATAATTTTGGTGTCCCTGAAGTCACCCTGCGGCGCTTCCTGAAA
ATGCCGGAAGGGGCTGCACCGGATGGCAGCGGTGTCCCGGTACTGGCTGTGTTCCGTGTAAAAAACGGTA
CGCTGGCCCGGATCCTGAAATTCACTCTCGGTCCACTGGAGCTGTGGGCACTGAATTCCTCACCCAAAGA
CAGCGCCCTGAGACGTGCGCTGACGCAGGAGCTCGGGTCACTGCGGGCACGCCAGATCCTGGCAGAACAC
TTTCCCCGTGGTTCAGCCACCTCACTGATAGAACACCGCGCCCGTACACATGACAGTGAAAACGTCATCC
ATGATCTGGCTGCAGAACTCATCCGTAAGCAGGGATATCACCTCTGA
 Primer design