SecReT4
Protein ID: 218711135
T4SS name [ID]Tra_I [168]
Gene symboltraT
Locus tagpECED1a_0111
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]83094..83912 [-]
Producthypothetical protein
Component typeTraT_I
UniProt IDB7LIQ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 272 a.a.     [Download]
>gi|218711135|ref|YP_002418755.1| hypothetical protein pECED1a_0111 [Escherichia coli ED1a]
MKKTPPLIAPVRERWLFPLPQPDTVFSGESLLPPPVLSTPGRCPCCRRTVTHRFILEDSWPLQQMADTCR
DTVVLLEKNLTRVMRLKKHPVPENADEKKKHTRTLQDAERSLAQARLSARRLALRHVEKSQIVTTDALSE
NESELLQPEGPPFHLCAFCHAWHCLNGYAAAQGVMVWLPDLHPASVVALNARALKEIFSDERKRVRQGRA
VLNALVQNRLAVEEKFRTWRPADFADALRRWPPAQRKTLREKMDGVALILMPDSFPDKKYVM
 
Nucleotide Sequence: 819 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c83912-83094 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGAAAAAGACCCCGCCACTCATCGCCCCGGTCCGGGAACGCTGGCTTTTCCCGCTCCCGCAACCGGACA
CGGTATTCAGCGGTGAATCCCTGCTGCCACCACCCGTGCTCTCAACACCCGGACGCTGTCCCTGCTGTCG
CAGGACCGTCACTCACCGCTTCATTCTGGAGGATTCATGGCCATTACAGCAGATGGCTGACACCTGCCGG
GATACGGTCGTCCTGCTGGAAAAAAACCTCACCCGGGTGATGCGCCTGAAAAAACATCCGGTACCGGAAA
ACGCTGACGAAAAAAAGAAACACACCCGAACCCTGCAGGATGCGGAGCGGTCCCTGGCACAGGCCCGCCT
GTCGGCCAGGCGACTGGCCCTGCGTCATGTGGAAAAGTCACAAATCGTCACAACAGATGCACTCAGCGAA
AATGAAAGTGAACTGCTGCAGCCGGAAGGCCCGCCCTTTCATCTCTGTGCCTTCTGCCACGCCTGGCACT
GCCTGAACGGCTACGCTGCCGCACAGGGGGTGATGGTCTGGCTCCCTGATTTGCATCCGGCCTCGGTAGT
TGCTCTCAATGCACGGGCACTGAAGGAAATTTTCAGCGATGAGCGTAAGCGAGTCAGACAGGGACGGGCC
GTACTGAATGCCCTGGTACAGAACCGCCTGGCCGTTGAGGAGAAATTTCGCACCTGGCGTCCGGCGGATT
TTGCTGATGCACTGCGCCGCTGGCCGCCGGCACAGCGTAAAACACTGCGGGAGAAGATGGACGGGGTGGC
GCTCATTCTGATGCCAGATTCGTTTCCTGACAAAAAGTACGTCATGTGA
 Primer design