SecReT4
Protein ID: 218711136
T4SS name [ID]Tra_I [168]
Gene symboltraS
Locus tagpECED1a_0112
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]83827..84078 [-]
Productconserved hypothetical protein, putative conjugal transfer protein
Component typeTraS_I
UniProt IDB7LIR0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 83 a.a.     [Download]
>gi|218711136|ref|YP_002418756.1| conserved hypothetical protein, putative conjugal transfer protein [Escherichia coli ED1a]
MSCELPPFTLLRTEHGNVIARDNRDNQEFVFAECYSTAIAALILAAVTLYTERKAYEKDPATHRPGPGTL
AFPAPATGHGIQR
 
Nucleotide Sequence: 252 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c84078-83827 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGTCCTGTGAACTGCCCCCTTTCACCCTGCTCAGAACAGAGCACGGCAACGTGATTGCCCGCGACAACC
GGGATAATCAGGAGTTTGTGTTTGCAGAGTGTTACTCCACCGCTATAGCAGCACTGATTCTGGCTGCCGT
CACCCTGTATACAGAGAGAAAAGCGTATGAAAAAGACCCCGCCACTCATCGCCCCGGTCCGGGAACGCTG
GCTTTTCCCGCTCCCGCAACCGGACACGGTATTCAGCGGTGA
 Primer design