SecReT4
Protein ID: 218711137
T4SS name [ID]Tra_I [168]
Gene symboltraR
Locus tagpECED1a_0113
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]84135..84533 [-]
Producthypothetical protein
Component typeTraR_I
UniProt IDB7LIR1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 132 a.a.     [Download]
>gi|218711137|ref|YP_002418757.1| hypothetical protein pECED1a_0113 [Escherichia coli ED1a]
MSRLRAMAARLRAASVYVQLCLMACRDRLVRLLLLLPVMLLPHTAMANTLFDMIKTVGDGARGSSSSFVA
IGQVIGLVLFIGGLLGLKQIGKKPGAGLACLLSILVGLCLAVVPELMGSGQKTLGLSPVSIS
 
Nucleotide Sequence: 399 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c84533-84135 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGTCACGACTTCGTGCCATGGCGGCGCGTCTGCGCGCTGCATCTGTTTATGTTCAGTTATGCCTGATGG
CCTGCCGTGACCGGCTGGTACGCCTGTTACTGCTGCTTCCCGTGATGCTGCTGCCCCACACTGCAATGGC
AAATACCCTCTTCGATATGATTAAAACCGTTGGCGATGGTGCCAGAGGCTCCAGCAGTTCGTTTGTGGCT
ATCGGTCAGGTTATTGGCCTGGTGCTCTTTATCGGTGGCCTGCTTGGCCTCAAACAAATCGGTAAAAAAC
CCGGTGCAGGGCTGGCCTGCCTGCTGTCAATTCTGGTCGGCCTCTGCCTTGCCGTCGTACCGGAACTGAT
GGGCAGCGGACAGAAAACGCTCGGTCTTTCTCCGGTTTCAATCAGTTAA
 Primer design