SecReT4
Protein ID: 218711138
T4SS name [ID]Tra_I [168]
Gene symboltraQ
Locus tagpECED1a_0114
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]84581..85111 [-]
Productconserved hypothetical protein, putative permease
Component typeTraQ_I
UniProt IDB7LIR2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 176 a.a.     [Download]
>gi|218711138|ref|YP_002418758.1| conserved hypothetical protein, putative permease [Escherichia coli ED1a]
MMSIDALTAIENFASGIFSAGMEFLFTWGELLGIIGLIGHLMRARAEGRHSMGPGKFIAGIFICGMLVSL
PSMINAGGTQMGFRADSFAPIAYVQPGSFGAAAGAVNAILSLAKLAGVGFVMNGISIWRKSLLDGHTALS
ASESISKGNVKFVAGVLLVFNDRVIDATLASLGIAF
 
Nucleotide Sequence: 531 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c85111-84581 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGATGAGCATTGATGCCCTGACAGCCATAGAGAACTTTGCCAGCGGTATTTTCAGTGCAGGCATGGAGT
TTCTCTTTACCTGGGGAGAGCTGCTGGGGATTATCGGCCTTATCGGTCATCTGATGCGCGCCCGGGCAGA
AGGACGTCACAGTATGGGACCGGGAAAATTTATTGCCGGTATCTTCATCTGCGGCATGCTGGTCAGTCTG
CCCTCAATGATCAATGCCGGTGGTACCCAGATGGGCTTCAGGGCAGATTCTTTCGCCCCCATCGCATACG
TGCAGCCGGGCTCCTTTGGTGCCGCTGCCGGTGCCGTCAATGCCATTCTCTCACTGGCAAAACTGGCCGG
CGTCGGTTTTGTCATGAACGGCATATCCATCTGGCGCAAATCACTGCTGGACGGGCATACCGCCCTGAGC
GCCAGTGAATCCATCAGTAAGGGGAACGTCAAGTTTGTGGCCGGCGTTCTGCTGGTTTTCAACGACCGGG
TTATCGATGCCACTCTGGCAAGCCTCGGTATCGCCTTCTGA
 Primer design