SecReT4
Protein ID: 218711139
T4SS name [ID]Tra_I [168]
Gene symboltraP
Locus tagpECED1a_0115
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]85108..85821 [-]
Producthypothetical protein
Component typeTraP_I
UniProt IDB7LIR3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|218711139|ref|YP_002418759.1| hypothetical protein pECED1a_0115 [Escherichia coli ED1a]
MKNEHEDPGSFGETTTPASGKSFLKRQYMGYSLPVWAGCVLIILAAVWYKFLRTPSEPPADAGFAVTPPA
AESWAEPMPMTETGSGNTMSVPPVTPQADMQQLARDLKAELDRRDEEIRRTLTMLKDSITTLSNAIQKDE
AWAQETRQLLEETRKQVHTLQMQGALPVPTGNNRQPAKTLPSPLQGMKIMSVEKGMAWIRWQGSAWAVRE
GDSLGNITITRIDPSSRAVITSAGTLR
 
Nucleotide Sequence: 714 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c85821-85108 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGAAAAACGAACATGAAGATCCCGGCAGTTTTGGCGAAACAACGACACCGGCATCCGGCAAATCCTTCC
TGAAACGCCAGTATATGGGATACAGCCTGCCAGTCTGGGCCGGCTGTGTCCTCATCATCCTGGCCGCAGT
CTGGTACAAGTTTCTGCGGACACCCTCAGAGCCCCCTGCAGATGCAGGCTTCGCTGTCACACCGCCCGCA
GCCGAAAGCTGGGCAGAGCCCATGCCCATGACGGAGACCGGGAGCGGAAACACCATGTCCGTGCCTCCTG
TCACCCCACAGGCAGACATGCAGCAGCTTGCCCGTGACCTGAAAGCAGAGCTGGACAGGCGGGATGAGGA
AATCCGGCGCACCCTGACCATGCTGAAGGACAGTATCACCACCCTCAGTAACGCCATTCAGAAGGATGAG
GCCTGGGCACAGGAAACCCGTCAGTTGCTTGAGGAGACCCGTAAGCAGGTGCATACCCTGCAGATGCAGG
GAGCACTGCCAGTCCCGACCGGGAATAACAGACAGCCTGCGAAAACCCTGCCTTCACCTCTGCAGGGCAT
GAAAATCATGTCGGTGGAGAAAGGCATGGCCTGGATCCGCTGGCAGGGCAGTGCCTGGGCAGTACGGGAA
GGCGACAGTCTGGGAAACATCACCATCACCCGGATTGACCCGTCCAGCCGGGCAGTCATCACCTCTGCCG
GTACATTACGATGA
 Primer design