SecReT4
Protein ID: 218711140
T4SS name [ID]Tra_I [168]
Gene symboltraO
Locus tagpECED1a_0116
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]85818..87155 [-]
Producthypothetical protein
Component typeTraO_I
UniProt IDB7LIR4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 445 a.a.     [Download]
>gi|218711140|ref|YP_002418760.1| hypothetical protein pECED1a_0116 [Escherichia coli ED1a]
MSAEQEQDTAEKSGKKLSALLVMGGVIIIGGGYLLLTWLSPENAASLSSVNINSTTSGGGRNVMETQHYR
DLLRADNERGAAEALRNNETFIASLPRGLDTDTGNDQKRDNPPDDQSGTSGQNASPPQEDQTAREKQREA
LQKLLARINTQHPDARPPVVAAAMWGTTGAPGISSHASPPGTGTSPQPRLQEASLATPAARTGIQLIPAL
TRVPAFIDTEVDSDNAVSRVVASVPAGPWAGAVLYSQDARLAGKGMDIHFDRMMWRGMFLKVNAYALNEH
TGMSSVASDVNHRWFKHIVLPSVLGGAGSVGSLYKDANTQVIQGNYGSITGRVGMPDGEALAGVIAGGMA
ERGSQLLTRQAESEPYRQVTVSRGEVVSILFVEPVMSNDISPPSSGTAPSVPPPSGRPLTQEEAERQASD
RIQAAVIRKQNEMRQRYGIQQESHP
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c87155-85818 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGAGCGCAGAACAAGAACAGGACACAGCCGAAAAATCCGGCAAAAAGCTGTCAGCCCTGCTGGTTATGG
GGGGCGTGATTATCATCGGGGGCGGATACCTGCTGCTCACCTGGCTGTCCCCCGAAAACGCTGCATCGCT
CTCGTCAGTCAATATCAACAGCACAACGTCCGGCGGCGGACGGAACGTGATGGAGACACAGCACTACCGG
GATTTACTGCGGGCTGACAATGAACGTGGTGCTGCAGAAGCGTTACGTAATAACGAGACGTTTATCGCCA
GTCTGCCCCGGGGACTGGATACCGATACCGGAAACGATCAGAAAAGGGATAATCCCCCCGATGATCAGTC
AGGCACTTCCGGGCAAAACGCATCCCCCCCTCAGGAAGATCAGACGGCCCGGGAAAAACAGCGGGAAGCG
TTACAAAAACTGCTTGCCCGCATCAACACACAGCATCCTGACGCCCGCCCCCCGGTAGTGGCGGCTGCAA
TGTGGGGCACCACTGGTGCTCCCGGGATAAGCTCACATGCCTCACCACCCGGTACCGGCACATCACCACA
ACCACGTCTGCAGGAGGCCAGTCTGGCAACCCCGGCAGCTCGTACAGGGATACAGCTGATACCGGCACTG
ACCCGCGTACCTGCCTTCATTGATACGGAAGTGGACTCTGACAATGCTGTCTCCCGCGTGGTGGCCTCCG
TACCTGCCGGCCCATGGGCCGGGGCCGTCCTCTACAGCCAGGACGCCAGACTCGCCGGCAAGGGAATGGA
TATCCACTTTGACCGGATGATGTGGCGGGGCATGTTTCTGAAAGTCAATGCATATGCCCTGAATGAACAT
ACCGGCATGTCATCCGTGGCCAGCGACGTGAACCACCGCTGGTTTAAGCATATCGTTCTGCCGTCTGTGC
TCGGTGGGGCGGGCAGTGTCGGGAGTCTTTACAAAGACGCCAACACACAGGTCATTCAGGGAAACTACGG
CAGCATTACCGGCAGGGTGGGAATGCCTGATGGCGAGGCGCTGGCCGGCGTCATTGCAGGCGGCATGGCC
GAACGGGGCAGTCAGTTGCTGACCCGCCAGGCGGAGAGCGAACCTTACCGGCAGGTGACAGTGTCACGCG
GAGAGGTTGTCTCCATTCTGTTTGTTGAGCCGGTCATGAGCAACGATATCAGTCCCCCCTCCTCCGGCAC
TGCCCCTTCTGTGCCACCGCCCTCCGGACGCCCGCTCACCCAGGAAGAAGCAGAGCGTCAGGCGTCTGAC
AGGATCCAGGCAGCTGTCATACGTAAACAGAACGAAATGCGGCAACGTTACGGAATACAACAGGAAAGTC
ATCCATGA
 Primer design