SecReT4
Protein ID: 218711141
T4SS name [ID]Tra_I [168]
Gene symboltraN
Locus tagpECED1a_0117
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]87159..88238 [-]
Producthypothetical protein
Component typeTraN_I
UniProt IDB7LIR5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3625 [PF12293], Evalue: 1.1e-88, Aligned region: 111..357
Protein Sequence: 359 a.a.     [Download]
>gi|218711141|ref|YP_002418761.1| hypothetical protein pECED1a_0117 [Escherichia coli ED1a]
MKSLSGALTPASNPAAWKSARWFPVTPHQEPETHIMQIHHLLGALLIVCGTVTAADNPGWQNARTPQAGG
KTGQAPGSAPAGGPPPATQLTGSLPPPASPLVQEAASLDSPLNAGEIRELRGRMADNERAISAPVTSVVP
RISSLTVNLSPGASLPLVRTALHNVSVVTFTDINGSPWPQSDPPYNAAPGHFDVQFNGNMVSVTPLRAWA
AGNVTVYLKGLSVPVILNITSGETDTNTLSQEIDSRLDLRIPRQGPASPVVAVPSEKIALHDATLQAFLD
GVPPDDPAIRRLKFSGNVPDTTIWQHGDDLLVRSRAMLRDEFEQTLASADGTRLWKLPVTPLLTFSVNGQ
SVHVTPELE
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c88238-87159 Escherichia coli ED1a plasmid pECOED, complete sequence
TTGAAATCACTGTCCGGCGCGTTGACCCCCGCATCAAACCCGGCGGCATGGAAATCAGCCAGATGGTTTC
CCGTAACGCCGCATCAGGAACCTGAGACTCATATCATGCAAATACATCATCTTCTTGGCGCACTGCTTAT
TGTGTGCGGCACTGTCACGGCTGCAGATAACCCGGGCTGGCAGAACGCACGAACCCCACAGGCTGGCGGA
AAGACAGGACAGGCTCCCGGGAGCGCCCCCGCAGGCGGCCCCCCGCCAGCCACACAACTCACAGGCTCCC
TGCCGCCACCTGCCTCTCCCCTTGTTCAGGAAGCCGCATCACTGGATTCCCCCCTGAATGCAGGTGAAAT
TCGGGAACTGCGGGGACGAATGGCCGATAACGAACGGGCCATCAGCGCACCTGTCACCAGTGTGGTGCCC
CGTATCAGCTCCCTCACGGTAAATCTGTCACCCGGGGCCAGTCTGCCGCTTGTCCGAACCGCACTGCATA
ACGTCAGCGTGGTAACGTTCACGGACATCAACGGCTCCCCGTGGCCTCAGTCGGATCCGCCTTATAACGC
GGCACCCGGTCACTTTGATGTGCAGTTCAACGGCAATATGGTCTCCGTCACTCCCCTGCGCGCCTGGGCT
GCAGGGAATGTAACGGTCTACCTCAAAGGACTGTCTGTACCGGTCATTCTGAATATCACCAGTGGTGAAA
CCGACACCAATACCCTGAGTCAGGAAATCGACAGCCGTCTGGATCTGCGCATTCCCCGTCAGGGACCTGC
CAGTCCTGTGGTAGCCGTACCATCAGAGAAGATTGCCCTGCATGATGCCACCCTGCAGGCCTTTCTGGAC
GGTGTGCCACCGGATGATCCCGCCATCCGCCGCCTGAAATTCTCCGGTAACGTCCCGGACACCACCATCT
GGCAACACGGCGATGATCTTCTCGTGCGCTCACGGGCCATGCTGCGGGATGAATTTGAACAGACGCTGGC
ATCGGCTGATGGTACGCGGCTGTGGAAACTGCCGGTGACCCCCTTACTCACCTTCTCCGTGAATGGTCAG
TCCGTTCACGTCACCCCGGAACTGGAGTAA
 Primer design