SecReT4
Protein ID: 218711142
T4SS name [ID]Tra_I [168]
Gene symboltraM
Locus tagpECED1a_0118
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]88144..88839 [-]
Producthypothetical protein
Component typeTraM_I
UniProt IDB7LIR6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 1e-33, Aligned region: 78..185
Protein Sequence: 231 a.a.     [Download]
>gi|218711142|ref|YP_002418762.1| hypothetical protein pECED1a_0118 [Escherichia coli ED1a]
MSEAQPTSPVSPEADNSGDIYNPVLRTIAQSEQRAALVPGLVRALLCSGAALCISLVANGIQYWHATGVT
REYFATDNGRLVRLAPTSQPAWSQSDVMNFGSMTLSEAFNLDFVHYRKQITTQAPRFSEAGFAGYVNALQ
ASNILDTIKKEKFNLTTTIGAGTLVNQGQMENGVWFWKFQYPVRMRLVGQTSTRPEQAFTFEITVRRVDP
RIKPGGMEISQMVSRNAASGT
 
Nucleotide Sequence: 696 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c88839-88144 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGAGCGAAGCACAACCCACCTCCCCTGTCTCACCGGAAGCGGATAACAGCGGAGATATTTATAACCCCG
TGCTCAGAACCATCGCACAGTCAGAACAACGGGCCGCGCTGGTACCCGGTCTGGTCAGGGCGTTGCTGTG
CAGCGGCGCAGCACTCTGCATCAGCCTGGTGGCTAATGGCATACAGTACTGGCATGCCACCGGCGTGACG
CGCGAATACTTTGCCACTGACAATGGCCGACTGGTCCGTCTGGCACCAACCAGCCAGCCGGCCTGGAGTC
AGAGCGACGTCATGAACTTTGGCAGCATGACGCTGAGCGAAGCCTTCAATCTCGATTTTGTCCACTACAG
AAAACAAATCACGACACAGGCCCCCCGCTTTTCCGAAGCCGGCTTTGCCGGCTATGTGAATGCCCTTCAG
GCCTCGAACATTCTCGACACTATTAAAAAGGAGAAATTTAACCTCACAACCACTATCGGGGCAGGTACCC
TGGTCAACCAGGGACAGATGGAGAACGGTGTCTGGTTCTGGAAATTCCAGTATCCGGTCAGGATGCGCCT
GGTCGGTCAGACCAGCACCCGCCCCGAACAGGCCTTCACCTTTGAAATCACTGTCCGGCGCGTTGACCCC
CGCATCAAACCCGGCGGCATGGAAATCAGCCAGATGGTTTCCCGTAACGCCGCATCAGGAACCTGA
 Primer design