SecReT4
Protein ID: 218711143
T4SS name [ID]Tra_I [168]
Gene symboltraL
Locus tagpECED1a_0119
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]88851..89201 [-]
Producthypothetical protein
Component typeTraL_I
UniProt IDB7LIR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|218711143|ref|YP_002418763.1| hypothetical protein pECED1a_0119 [Escherichia coli ED1a]
MNMKKTLLVILTGITLASPVAGAATCRAGAAAEAGSRAAWERARTASQAWSQRENDVASSLQSCLSRIKD
ISITLPQFPSLDKLLRDLENQVCDAVVDRVNDHLPGNIDPWKDYNL
 
Nucleotide Sequence: 351 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c89201-88851 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGAACATGAAAAAAACGCTGCTGGTCATACTGACCGGCATCACCCTGGCATCACCGGTGGCAGGTGCCG
CCACCTGCCGGGCGGGGGCCGCTGCCGAAGCCGGCAGCAGAGCCGCCTGGGAGCGGGCGCGCACAGCCAG
CCAGGCATGGTCACAGCGGGAGAATGACGTCGCCTCCTCCCTGCAGTCCTGCCTGTCCCGCATCAAGGAC
ATCAGTATCACTCTTCCGCAGTTCCCCAGCCTGGACAAGCTCCTCCGCGACCTGGAAAACCAGGTCTGTG
ATGCCGTCGTGGATCGGGTGAATGACCATCTTCCGGGGAATATCGACCCCTGGAAAGACTACAACCTCTG
A
 Primer design