SecReT4
Protein ID: 218711145
T4SS name [ID]Tra_I [168]
Gene symboltraK
Locus tagpECED1a_0121
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]93343..93633 [-]
Producthypothetical protein
Component typeTraK_I
UniProt IDB7LIR9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 96 a.a.     [Download]
>gi|218711145|ref|YP_002418765.1| hypothetical protein pECED1a_0121 [Escherichia coli ED1a]
MKREGFWRDVTPPLNIYGVPLPFTMIYLLLFPYPSKTTFWVCSGILLFFVLLGYSGWTVRTLCRRLYSLV
QGKQASGRPWWYRHRTELPREWRGTE
 
Nucleotide Sequence: 291 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c93633-93343 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGAAACGCGAAGGCTTCTGGCGGGATGTCACTCCGCCACTGAATATTTATGGTGTCCCGTTGCCGTTTA
CCATGATTTACCTGCTGCTGTTTCCGTATCCGTCAAAAACAACATTCTGGGTGTGCAGCGGCATTCTGCT
GTTTTTTGTGCTCCTGGGGTACTCAGGATGGACTGTCCGGACGCTCTGCCGGCGTCTGTACAGCCTGGTG
CAGGGTAAACAGGCGTCAGGCCGTCCCTGGTGGTACCGGCATCGCACAGAATTACCCCGTGAATGGCGCG
GAACGGAATAA
 Primer design